(data stored in ACNUC7421 zone)

EMBL: CP002047.PE189

CP002047.PE189       Location/Qualifiers
FT   CDS_pept        complement(210017..210754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00189"
FT                   /product="NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03310"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF4"
FT                   /protein_id="ADI03310.1"
FT                   /translation="MSPTDPVGRPAVIELRQYTLRPGRRDELIELFDREFVETQEETGM
FT                   VVLGQFRDLDDPNRFVWLRGFPDMAVRHRALTAFYGGPVWAEHGPQANDTMVDSDDVLL
FT                   LRPLSDGSGFAVSPSERPQAGAPAPDRFVSATVWSFPPGRPDGIALIRDGLLPVLHKTG
FT                   PAPLAVLTTETAHNTFARLPVRTGENVAAVFTSYPDESAYRRHLAEVQDHPLTREILPG
FT                   IEREQTAAPRTLRLAPTGRSLIS"
     gtgtcaccca ccgaccccgt cggccgccca gctgtgatcg agcttcgcca gtacacgctg        60
     cgtcccggcc gtcgtgacga gctcatcgag ctgttcgacc gggagttcgt cgaaacgcag       120
     gaagagaccg ggatggtcgt gctcggccag ttccgggacc ttgacgatcc gaaccgcttc       180
     gtctggctgc gcgggttccc ggacatggcg gtacggcacc gtgcgctgac ggccttctac       240
     ggcggacccg tctgggccga gcacggtccc caggccaacg acaccatggt cgactccgac       300
     gatgtcctgt tgctgcggcc cctgtcggac gggagcggct tcgccgtcag cccgtccgag       360
     cggcctcagg ccggtgctcc ggcaccggac cggttcgtgt ccgccaccgt gtggtccttc       420
     cctccaggac ggcccgacgg catcgcactc atccgggacg gccttctccc cgtgctccac       480
     aagacggggc ccgcgccact cgccgtcctg accaccgaga cggcacacaa cacattcgcc       540
     aggctgccgg tccgcacggg ggagaacgtc gccgcggtct tcacctcgta ccccgacgaa       600
     agtgcctatc gccggcacct cgccgaagtg caggaccacc ccctcacccg ggagattctg       660
     ccgggcatcg agagagaaca gacagcagcc ccccggacac tgcgcctggc acccacaggc       720
     cgctcgctca tctcctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page