(data stored in ACNUC7421 zone)

EMBL: CP002047.PE19

CP002047.PE19        Location/Qualifiers
FT   CDS_pept        complement(15555..18362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00019"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /note="COG1204 Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03140"
FT                   /db_xref="GOA:D7BSW3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW3"
FT                   /protein_id="ADI03140.1"
FT                   /translation="MTVTAISPAGPAASFARQPAPAWPPDLPLPAETEKRALLWCKATD
FT                   PNWRPSEQALAAAEDIRVIVPTSPDFDPLRTFLAEHGVPVRSAGHWAETEQVSTVGDLG
FT                   SRTDLVAFTSITGSVPSAPAAGPAAYAARDAFAAQWDALADLPPDEAAAYVPVTGLVPG
FT                   DWKELLPHPAFNPVQAAAVPAVLESDQHLVIVAPTGAGKTAIGMVAALQAHTRGRKAAW
FT                   LVPQRSLTDELDRDLETWRRAGRRVVRLTGEYAVDTELIRTADLWVATTEKFEAISRTG
FT                   SLRAALAEVGCLIVDEIHLLGDPTRGPVLEALLARVREDSAQVRIAGLSATVANAGQVA
FT                   DWLGARLIRSPWRPTRLTWQLPVLPNAADAPEWNARAQARTAEAVRLTRAITTTGGSVL
FT                   VFCGSKRGVRATALALAADRGVPTRGADTDDSELVERLCTRAGVRLHYRDWPYKRESEH
FT                   AFRTRQADILVATSTVAAGVNLPARAVIVRDTQVGMDRIEVSMVQQMFGRAGRVGAGER
FT                   EGWAYLLTSPTERAPWQARLAAGYTVTSRIRDHLPDHVLAEAVQGRLRDLDQAELWWTK
FT                   TFAHYQGHHHLDPLHDALDFLNDAGYLHRTPDPGGNDNLTITETGKLTSRFMVEADTAT
FT                   TLTDTLQLLPVPGSPDEAENTLITLLSTHLPALEQAPFTERAKTALYQVLRAGGHTDAA
FT                   HAPQPPGEDEDKPAAGDLARAVLLLVANSPKAFRTRSSYILGIPVDSMAQILDEARRYL
FT                   AWIAAQGHLGTIHPWAAITASDLAQRIRWRTLGPRRGSGRLLWMCERMATPAHVHRLVP
FT                   TMWRAARDRGIDAPDWPGTTSPSTCRLHPDDYRALLATRTTGIDLETRPDGIRVHAPRG
FT                   TVIHLWTDATVARHTADGTTCELPYPAPLPSHDAQVEHGGAVFTRGDYLVTGWLSAYNS
FT                   IAPRA"
     atgacggtga ccgcgattag cccggccggc cctgccgcct ccttcgcgcg acagcccgcg        60
     cctgcctggc cgccggacct tcccctgccg gcggagaccg agaagcgcgc cctgctgtgg       120
     tgcaaagcaa ccgaccccaa ctggcggccg tccgagcagg ccctggcagc tgccgaggac       180
     atccgggtca tcgtcccgac gagcccggac ttcgacccgc tgcgcacctt cctggccgaa       240
     cacggtgttc cggtccgcag cgccggccac tgggcggaga ccgagcaggt ctccaccgtc       300
     ggcgacctcg gcagccgcac ggatctggtg gccttcacct ccatcaccgg cagtgtcccc       360
     agcgccccgg cagccggccc ggccgcgtac gcggctcgag acgcgttcgc cgcgcagtgg       420
     gatgcgcttg cggacctgcc cccggacgag gcggcagcct acgtcccggt gaccggcctg       480
     gtccccgggg actggaagga actgctgccg caccccgcct tcaaccccgt ccaggccgcg       540
     gccgtccccg ctgtcctgga atccgaccag cacctggtga tcgtcgcgcc caccggcgca       600
     gggaagaccg ccatcggcat ggtggcagcc ctccaggctc acacccgcgg ccgcaaggcg       660
     gcctggctgg tgccccagcg gtccctgacc gacgaactcg accgcgacct ggagacctgg       720
     cgccgcgccg gccgccgcgt cgtgcgcctc accggtgaat acgccgttga taccgaactc       780
     atccgcaccg cggacctctg ggtggccacc acggaaaagt tcgaggcgat cagccgcacc       840
     ggctccctgc gcgcagccct cgccgaggtc ggctgcctga tcgtcgacga gatccacctg       900
     ctcggcgacc ccacccgcgg accagtcctc gaagcgctcc tggcccgtgt ccgcgaggac       960
     agcgcccagg tccggatcgc gggcctgtcc gccacggttg ccaacgccgg gcaggtcgcc      1020
     gactggctgg gcgcgcgcct tatccgctca ccctggcgcc ccacgcgtct gacctggcaa      1080
     ctgcccgtcc tgccgaacgc ggccgacgcc ccggaatgga acgcccgggc ccaggcccgt      1140
     accgcggagg ctgtacgtct gacgcgagcg atcaccacaa caggtggcag cgtcctggtc      1200
     ttctgcggca gcaagcgagg cgtgcgtgcc accgcccttg ccctggccgc cgaccgcggc      1260
     gtgccgacca ggggcgccga caccgatgac agcgaactcg tcgagcggct gtgcacccgc      1320
     gccggtgtgc ggctccacta ccgcgactgg ccctacaagc gagaatccga acacgccttc      1380
     cgcacccgcc aggccgacat cctggtcgcc acctccaccg tggccgctgg agtcaacctg      1440
     cccgcccggg ccgtcatcgt ccgcgacacc caggtcggta tggaccgcat cgaggtctcc      1500
     atggtccagc agatgttcgg ccgcgccggc cgcgtggggg ccggcgaacg cgaaggctgg      1560
     gcctacctgc tgaccagccc caccgaacgg gctccgtggc aggcgcgcct cgccgccgga      1620
     tacaccgtca cctcccgtat ccgcgaccac cttcccgatc atgtcctggc cgaagccgtc      1680
     cagggacgac tgcgcgacct ggaccaggcc gaactgtggt ggaccaagac cttcgcccac      1740
     taccagggac accatcacct cgaccctctg cacgacgccc tggacttcct caacgacgcc      1800
     ggctacctcc accgcacccc tgaccccggc ggcaacgaca acctgaccat taccgaaacc      1860
     gggaagctca ccagccgctt catggtcgaa gccgacactg ccaccaccct caccgacacc      1920
     ctgcaactcc tccctgtccc cggcagcccc gacgaggccg aaaacaccct catcaccctg      1980
     ctcagcactc acctgcccgc cctcgaacaa gccccgttca ccgaacgcgc caaaaccgcc      2040
     ctctaccagg tcctgcgcgc tggcggacac accgacgcag cccacgcccc acaacccccg      2100
     ggggaggacg aggacaagcc cgccgccggc gacctcgccc gtgctgtcct gctcctggtg      2160
     gccaacagcc ccaaggcatt ccgcacccgc agcagctaca tcctgggcat ccccgtcgac      2220
     tccatggcac agatcctcga cgaagcccgc cgctacctcg cctggatcgc agcccaaggc      2280
     cacctcggca ccatccaccc ctgggccgcc atcaccgcat ccgaccttgc ccagcgcatc      2340
     cgctggcgca ccctaggccc ccgccgtggc tcgggccgcc tgctctggat gtgcgaacgc      2400
     atggccaccc ccgcccacgt acaccgactc gtccccacca tgtggcgcgc cgcccgcgac      2460
     cgcggtatcg acgcccccga ctggcccggc accacctcgc ccagcacctg ccggctccac      2520
     cccgacgact accgcgccct cctcgccacc cgcaccacgg gcatcgacct tgagacccgc      2580
     ccggacggca tccgcgtcca tgccccgcgc ggcaccgtca tccatctgtg gaccgacgcg      2640
     accgtagccc gtcacaccgc cgacggcacc acatgcgaac tcccctaccc ggcacccctc      2700
     ccgagtcatg acgcgcaagt cgagcacggg ggagcggtgt tcacacgggg cgattacctg      2760
     gtcaccggct ggctgtccgc gtacaactcc attgccccac gggcttag                   2808
//

If you have problems or comments...

PBIL Back to PBIL home page