(data stored in ACNUC7421 zone)

EMBL: CP002047.PE190

CP002047.PE190       Location/Qualifiers
FT   CDS_pept        210902..211867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00190"
FT                   /product="helix-turn-helix type 11 domain protein"
FT                   /note="COG2378 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03311"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF5"
FT                   /protein_id="ADI03311.1"
FT                   /translation="MLSLLLLLQSRGRMSARGVADELGVSVRTAYRDLARLQAAGVPVY
FT                   AEPGRGGGYQLLDGYRTRLTGMSEGEARALFFAGLPGPAADLGLAAEVTAARLKLLAAL
FT                   PTGLREEAARTAAVFHLDAPGWYREPEQTPQLPLFVDAVLTGRAVDVRYRRWRAPQEVN
FT                   RRLRPYGLVLKSGTWYLVAAATDSRIATYRVTQVLDAVLSDERFDRPQGFDLGAYWTSY
FT                   LDDFQARRYTGTATIRLSPQGRRRLPDNVPPEVVRAVDSTATAVGDDGWVEAVIPTEST
FT                   YHACGELLRLGVDVEVVAPAELRQAMVATVGVLARAYGLH"
     ttgctgtcgc tgctgttgtt gctgcaatcc cgtggccgta tgtccgcgcg cggggtcgcc        60
     gatgagctgg gggtatccgt acggaccgcc taccgtgacc tggcacggct acaggccgcc       120
     ggggtcccgg tctacgcgga gccgggccgc gggggcggct atcagctgct cgacggctac       180
     cgcacccgcc tgaccgggat gagtgagggc gaggcacggg cgctgttctt cgccggactg       240
     cccgggcccg ccgccgacct gggcctcgcg gcggaggtga cggcggcacg gctgaagctc       300
     ctggccgcgc tgccgacggg actgcgcgag gaggcggcgc ggaccgcggc ggtgttccac       360
     ctggacgctc ccggctggta ccgggaacct gaacagacgc cgcagctgcc cttgttcgtc       420
     gacgcggtgc tcaccgggcg tgcggtggat gtgcgctatc gccgttggcg cgcgccacag       480
     gaggtgaatc gccgtctacg gccctacggc ctggtgctca aatccggaac ctggtatctc       540
     gtggccgccg ccacggacag ccggatcgcg acctaccggg tcacccaagt cctcgacgcg       600
     gtgctgagcg acgagcggtt cgaccggccg caaggattcg acctgggcgc gtactggacc       660
     tcgtacctcg acgatttcca ggcacgccgc tacaccggca ccgccaccat ccgcctgtcc       720
     ccgcagggac gccgacgcct gcccgacaac gtccccccgg aggtggtacg ggcagtcgac       780
     tccaccgcga ccgccgtcgg cgacgacgga tgggtcgagg ccgtcatccc gaccgagagc       840
     acctaccacg cgtgcggcga gctgctgcgg ctcggtgtcg acgtcgaggt cgtcgcgccg       900
     gccgaactgc gccaggccat ggtcgccacc gtgggcgtac tcgcccgggc ctacggactc       960
     cactga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page