(data stored in ACNUC7421 zone)

EMBL: CP002047.PE192

CP002047.PE192       Location/Qualifiers
FT   CDS_pept        complement(213217..213702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00192"
FT                   /product="transcriptional regulator, XRE family protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03313"
FT                   /db_xref="GOA:D7BWF7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF7"
FT                   /protein_id="ADI03313.1"
FT                   /translation="MSGSELARRAGLSKATLSQLEAGKGNPTIETLDALAIALRIPLTD
FT                   LLTRDTDPGPVFVAGTDLAEDEVGRELLRRISSGHSLEIWRLRMPVRTELAGVPHATGT
FT                   VEHLLVATGRLTAGPIDSPRLLGPGDLLAFAGDAPHIYRTDTEPADVTVVIASPIVS"
     atgagcggct ccgagctggc gcggcgtgcg ggcctgagca aggcgacgct gtcgcaactg        60
     gaggccggta aggggaaccc gacgatcgag acgctcgacg cgctcgcgat cgcgctcagg       120
     atcccgctga ccgacctgct gacccgcgac accgaccccg gcccggtgtt cgtcgccggc       180
     accgacctcg ccgaggacga ggtcggccgg gaactgctcc gccggatcag cagcggccac       240
     agcctggaga tctggcggct gcggatgcct gtccgcaccg agctggcggg tgtgccgcat       300
     gcgaccggca ccgtggagca cctgctggtc gccacgggcc ggctgaccgc cggacccatc       360
     gacagcccgc gcctgctggg gccgggcgat ctgctcgcct tcgccggcga cgccccccac       420
     atctaccgca ccgacaccga accggcggac gtcaccgtcg tcatcgcctc gcccatcgtc       480
     agctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page