(data stored in ACNUC7421 zone)

EMBL: CP002047.PE194

CP002047.PE194       Location/Qualifiers
FT   CDS_pept        complement(214614..214970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00194"
FT                   /product="hypothetical protein"
FT                   /note="COG4332 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03315"
FT                   /db_xref="InterPro:IPR009412"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWF9"
FT                   /protein_id="ADI03315.1"
FT                   /translation="MNVRSVRPELLDRLHDNDPGLTAELLQDPVVQRRNRIALDWDNAW
FT                   RLDTGGSDHLDREVIDVSVRFAVRIPVRPVRLIAEGCGLSRAEVERLITEGKLVSAVRL
FT                   SGKLCGDFTFTLKR"
     atgaatgtgc gctccgtacg acctgagctg ctggaccggc tgcatgacaa cgaccctggc        60
     ctgacagctg agctgctcca ggatccggtc gtgcagcgcc gtaatcgcat tgccctcgac       120
     tgggacaacg cctggcgcct cgacaccggc ggatcggatc acctggaccg cgaggtgatc       180
     gacgtctcgg tccgctttgc ggtgcggatt cctgtccggc cggtgcgact gatcgctgaa       240
     ggttgcggtc tttcgcgggc cgaggtcgag cggctgatca cggaggggaa gctcgtttcg       300
     gcagtccggc tgagcggcaa gctctgcggt gacttcacct tcacgctcaa gcgctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page