(data stored in ACNUC7421 zone)

EMBL: CP002047.PE195

CP002047.PE195       Location/Qualifiers
FT   CDS_pept        complement(215455..216504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00195"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03316"
FT                   /db_xref="GOA:D7BWG0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG0"
FT                   /protein_id="ADI03316.1"
FT                   /translation="MGWDMLVTEFSTEVVAAPERFELFSEVTAQSHVPNRLRSNDRDDF
FT                   RANMRVLHLGELEVSTLSFSHLEIVRTAKLIRQYDPDAYQINYILGEEGALSTAGGDTA
FT                   LQVGDLVVLDTSRPYHGDVHAVLGGWSHVTVQFPRKLMPLPEKTAQSLLGVAINGRRGM
FT                   GGVFARWLTDLNRRADEFTPADIPTLASVTLDLLASALARCADTEAALSPETRRNALRT
FT                   QINTFVEQRLTDPAMTPQAIADAHHISLRHLQQLFAESDTSPAAWIRRRRLERCRVDLA
FT                   NPSLKSRPIQAIAARWGFADPAHFSRLFRANYGMTPRDYRNLAVPFRRGPEAGGVGGTG
FT                   MRLSLGSRD"
     atggggtggg acatgttggt gaccgagttc agcacggagg ttgtggcagc gccggagcgg        60
     ttcgagctgt tcagcgaagt gaccgcgcaa tcgcacgtgc ccaaccgatt acgcagcaac       120
     gatcgggatg acttccgcgc caatatgcgt gttctgcatc tgggggagtt agaagtctcc       180
     acgttgtcct tttcgcatct ggagatcgtg cgaacggcga aactgatccg gcagtacgat       240
     cccgatgcgt accagatcaa ctatattctc ggtgaggagg gagctctctc cacggccgga       300
     ggtgacaccg cgctgcaggt cggtgacctg gtggtgctgg ataccagtcg gccctatcac       360
     ggcgatgttc acgccgttct gggcggttgg tcgcatgtga ccgtgcagtt ccctcggaaa       420
     ctgatgccgc tgccggaaaa gacggcgcag tctctcctcg gcgtcgcgat caacgggcgc       480
     cgcgggatgg gcggggtgtt cgcccgctgg ctgaccgacc tcaacaggcg cgccgacgag       540
     ttcaccccag ccgatattcc caccctcgcc tcggtcaccc tggacctcct ggcgtccgca       600
     ctcgcccgct gcgcggatac cgaggcggcg ctgagtccgg agacccgcag aaacgccctg       660
     cggacccaga tcaacacctt cgtcgaacag cgtctcaccg acccggccat gactccccag       720
     gcgatcgcgg acgcccacca catctctctg cgccacctcc agcaactgtt cgccgagagc       780
     gacacgtcac cagcagcctg gatacgccgt cgccgtctgg aacgctgccg cgtcgacctg       840
     gccaacccga gtctgaagag ccgaccgata caggccatcg cagcccgctg gggcttcgcc       900
     gacccggcac acttcagccg cctgttccgg gccaactacg ggatgacccc gcgggactac       960
     agaaacctgg ccgtgccctt tcgccgtggc cctgaggcgg gcggggtagg cgggaccggt      1020
     atgcgtctgt ccctcggcag ccgggattga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page