(data stored in ACNUC7421 zone)

EMBL: CP002047.PE197

CP002047.PE197       Location/Qualifiers
FT   CDS_pept        complement(217049..217633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03318"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG2"
FT                   /protein_id="ADI03318.1"
FT                   /translation="MASIHHTTMTPTKLELLSEWLPKQSWYVGNAKSPELVKAGGFRLD
FT                   DPKGAVGIEFMVVVDGTAQQPVAYLVPMGYRGAALEGAPGEALIGTSEHGVLGTRWIYD
FT                   GVHDPVVMAQLRALLRGEAVPQHQSKSDTPDPTVTVHGTGPGEGLDVHVNRVLRPTEAE
FT                   ATQRSSGHLVTEWTWPNGTAARGVLAAVAPR"
     atggcctcca tccaccacac caccatgacg cccaccaagc tggaactgct cagcgagtgg        60
     ctgccgaagc agagctggta cgtgggcaac gcaaaatcgc cggaactggt gaaggccggt       120
     gggttccgtt tggacgaccc aaagggcgcg gtcgggatcg agttcatggt cgtggtggac       180
     ggcaccgcgc agcagccggt ggcgtatctg gtgccgatgg gctaccgcgg tgcggcgctg       240
     gagggcgccc cgggcgaggc gctgatcggc acttctgagc atggggtgct cggtacccgg       300
     tggatctacg atggcgtcca cgacccggtg gtgatggcgc agttgcgcgc gctcctgcgc       360
     ggcgaggcgg tgccgcagca ccagagcaag agcgacaccc ctgacccgac cgtcaccgtg       420
     cacggcactg gccctggcga ggggcttgac gttcacgtca accgcgtcct gcggccgacg       480
     gaggccgagg ccacgcagag gtcgtccgga cacctcgtca ccgagtggac ctggccgaac       540
     ggaacggctg cacggggcgt actcgcggct gtggcgccac ggtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page