(data stored in ACNUC7421 zone)

EMBL: CP002047.PE198

CP002047.PE198       Location/Qualifiers
FT   CDS_pept        complement(217736..218227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00198"
FT                   /product="hypothetical protein"
FT                   /note="COG2606 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03319"
FT                   /db_xref="GOA:D7BWG3"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG3"
FT                   /protein_id="ADI03319.1"
FT                   /translation="MASQESTSLPVRSMQVARALAAAGIAGQVRELTESARTAAEAASA
FT                   LGCDVGAIANSLVFISDDEPVLVMTSGRHRVDTTALAARWGRGRLRRATAEQVRQATGQ
FT                   AIGGVAPVGHPRALPAVVDEALTDYSQVWAAGGTPHTIFPTTAGELVQLTGGLLLPVGP
FT                   "
     atggcgtccc aggaaagtac gtccctgccc gttcgcagca tgcaggtggc ccgcgccctc        60
     gccgcggccg gcatcgccgg ccaggtgcgc gagctgacgg agtcggcgcg cacggcggcc       120
     gaggccgctt cagccctggg gtgcgacgtg ggcgcgatcg ccaacagcct cgtgttcatc       180
     tccgacgatg agcccgtgct ggtgatgacc agcggccgac accgggtgga taccaccgca       240
     ctcgccgccc ggtgggggcg tggcagactc cggcgcgcca ccgccgagca ggtgcgtcag       300
     gccaccggac aggcgatcgg gggcgtggcg cccgtcggcc acccccgcgc ccttccggcc       360
     gtggtcgacg aagccctgac cgactactcc caggtctggg ctgccggcgg aactccccac       420
     acgatcttcc ccaccacggc cggcgaactc gtccagctca cagggggact gctgctcccg       480
     gtcggcccat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page