(data stored in ACNUC7421 zone)

EMBL: CP002047.PE199

CP002047.PE199       Location/Qualifiers
FT   CDS_pept        218349..218867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00199"
FT                   /product="putative transcriptional regulator, XRE family
FT                   protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03320"
FT                   /db_xref="GOA:D7BWG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG4"
FT                   /protein_id="ADI03320.1"
FT                   /translation="MDLAARVGLRLRELREAQDLSLSELARRSAIGKGTLSELEGGRRN
FT                   PTLETLYALTTALNVPLSTALHGLALPAEISGRAVDAVLTERFEDASAVTETYRIRIRA
FT                   GTTQESAAHSPGTTEHIVVLAGTARVGSLSAPVSIGPGMHGSWAADVPHLYQAPFGDVE
FT                   ALLVVRHPQ"
     atggatctgg ccgctcgcgt cggcttgcgc ctgcgggaat tgcgcgaagc gcaggatttg        60
     tcactgtccg agctggcgcg caggtccgcc atcggcaagg gaacactctc cgaactggaa       120
     ggcggacggc gcaaccccac gctggaaacg ctctacgccc tcacgacagc actcaacgtg       180
     cccctcagca cagcactgca cggactcgcg cttcccgccg agatctccgg tcgcgccgtg       240
     gacgccgtcc tcaccgagcg attcgaagac gcctccgcgg tcacggaaac ctaccgaata       300
     cgcatccgcg ccggaacgac acaggagtcc gccgcccact cccccggcac cacggagcac       360
     atcgtcgtac tcgcgggcac cgcacgagtc ggtagccttt ccgcccctgt ctcgatcggt       420
     cctggtatgc acgggagttg ggccgcggac gtgccgcacc tgtatcaggc accattcgga       480
     gacgtcgagg cgctgctggt cgtgcgccac ccgcagtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page