(data stored in ACNUC7421 zone)

EMBL: CP002047.PE2

CP002047.PE2         Location/Qualifiers
FT   CDS_pept        1302..1655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03123"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU6"
FT                   /protein_id="ADI03123.1"
FT                   /translation="MSYEYGGGPDWPIIRARRRAEEEASSARREDAAHKASAARWKTAF
FT                   EVPADQVRAAVVQAGVEHRPDGKCGRPSCWDAVITRLAGEAEGGGSAAGGPDSGFTFSF
FT                   GDLFGRPGPQGRP"
     atgtcctacg agtacggcgg cggtcccgac tggccgatca tccgggccag gcggcgcgct        60
     gaggaagagg ccagctcggc caggcgcgaa gacgcggccc acaaggcgtc ggcagcccgg       120
     tggaagaccg ccttcgaggt accggccgac caggtgcggg cggcagtggt ccaggcaggc       180
     gtggagcacc ggccggacgg caagtgcggc cgtccctcct gttgggatgc tgtcatcacc       240
     aggctcgccg gggaagccga aggaggcgga agcgctgccg gtggccccga ctccgggttc       300
     acgttttcct tcggcgacct gttcggccgc cctgggcccc agggacgtcc ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page