(data stored in ACNUC7421 zone)

EMBL: CP002047.PE20

CP002047.PE20        Location/Qualifiers
FT   CDS_pept        18660..18824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03141"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW4"
FT                   /protein_id="ADI03141.1"
FT                   /translation="MFLVGPSRLPEPREEVFLIKDGSPALPDEVGDCGLGRLFFHRTHG
FT                   TNFASNCHG"
     ttgttcctgg taggaccatc ccggctcccg gaaccgcgcg aggaggtctt cctcatcaag        60
     gacggttccc cagcgctgcc ggacgaggtc ggcgactgtg gccttggacg tctgttcttt       120
     caccgcacac acggcaccaa ctttgccagc aactgccacg gttga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page