(data stored in ACNUC7421 zone)

EMBL: CP002047.PE201

CP002047.PE201       Location/Qualifiers
FT   CDS_pept        220745..222022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00201"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03322"
FT                   /db_xref="GOA:D7BWG6"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG6"
FT                   /protein_id="ADI03322.1"
FT                   /translation="MVTLGFFITLEIAARHYGLPGPMTTQAQEVIFAPKSGPLLYASMA
FT                   LMMVVLTWRQRFIALGAAIGIDVVFVLVRWAVGAKITEGHPFGNGALWVMLGYGVIAVT
FT                   RRTGRERALLLKGVGLGLLLVAGRKTGDTWLLITSKTRPTVLDEYVATADHALGNPSWL
FT                   VGRIVRATDPIGTHLLDWVYIQLAVAAVVVSLYQLRHVAVERRFPSHYLVRTFLVIGLV
FT                   GPAIYMIFPVVGPIFAYGPGAYGTGGLHWAVADLWPDTPPPLNPPHPVPYDDITPRNCM
FT                   PSLHTAWATAIFIHSRKGPRILRFAGTFWLIATLTATLGFGYHYGVDLIAGVVFTLTIE
FT                   AALRSHERGWDRSGLQLVAYGTAVFAALLVSYRYLPMEMAKYPWVFGPLLILAMTSVIY
FT                   AYVRTTKLWEQKTTPAPQPEPQPELV"
     gtggtgaccc tcggattctt catcacgctg gagatcgccg cgcgtcacta cggcctaccg        60
     gggccgatga ccacccaggc gcaagaggtg atattcgccc ccaaatcggg gccgctgctg       120
     tacgccagta tggcattgat gatggtggta ctcacctggc ggcaacggtt catcgcgctt       180
     ggtgccgcga tcggcatcga cgtcgtcttc gtgctggtgc gatgggcggt cggcgccaag       240
     atcaccgagg gccacccctt cgggaacggc gcgttgtggg tgatgttggg ctacggggtc       300
     atcgctgtca ctcgccgcac cggccgggag cgtgccctgc tgctgaaggg cgtcggtctt       360
     gggctactgc tggtggcggg ccgcaagacc ggcgatacct ggctcctcat cacgtcgaag       420
     acccgcccaa ccgtgctcga cgagtatgtg gcaaccgccg atcatgcact gggcaacccg       480
     tcgtggctgg taggccggat tgtcagggcc accgacccga tcggcaccca ccttctcgac       540
     tgggtctaca tacagcttgc ggtggccgcg gtcgtcgtct cgctgtacca gctgcgccat       600
     gtggcggtcg agcgccgctt cccgagccat tatctggtgc gcacctttct ggtgatcggc       660
     ctcgtcgggc cggccatcta catgatcttc ccggtggtcg ggccgatctt cgcctatggc       720
     ccgggcgcct acggcaccgg cggcctgcac tgggcggtgg ccgacctatg gccggacaca       780
     ccaccgccgc tcaatccccc gcacccggtg ccgtacgacg acatcacccc gcgcaactgc       840
     atgcccagcc tgcacacagc gtgggctacc gcgatcttca ttcattcccg caagggccca       900
     cgcattctgc gattcgccgg cactttctgg ctgattgcca cgctcaccgc gacgctgggc       960
     ttcggctacc actatggcgt ggatctcatc gccggtgtgg tgttcacact cacgatcgag      1020
     gcagctctgc gctcgcacga acgtggctgg gaccggtcag gactccagct ggtcgcttac      1080
     ggcacagcgg tcttcgccgc gctcctggtg tcgtatcgct atctgccgat ggaaatggcc      1140
     aaatatccgt gggtgttcgg cccgcttctc atcctggcga tgacgtcagt gatctacgcc      1200
     tacgtacgga ccaccaaact gtgggagcag aagaccacac cagcgccgca accggaaccg      1260
     caacccgaac tggtctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page