(data stored in ACNUC7421 zone)

EMBL: CP002047.PE204

CP002047.PE204       Location/Qualifiers
FT   CDS_pept        complement(223701..225917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00204"
FT                   /product="TPR repeat-containing protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03325"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWG9"
FT                   /protein_id="ADI03325.1"
FT                   /translation="MLMLSGQAGVGKTALALRAAGEAVRRHWYVKGIYADVGRAAETSA
FT                   ETAVFTALGGLLHSLGVSEPQVAAVADGRVAQYRSVVSALAKRGKPVLVVLDSVSSLAE
FT                   AEPLLPPHPRNCAVVIGRHRLTGGGLAGACHHALGLFEPSEAVEFVVRALAAADEHDRR
FT                   AATDPEAVRALSMACGRLPLALDLAVGRLVTDRRMPVPTLADRLQDTPRPSAPEIQVDP
FT                   VRAVFARCCGRLPAGQARLLRLLSLYPGAHFGAEEAAALGGLPVAEAADVLMELSRARM
FT                   LAASGPRFGGHRFQGLLWSYATDLAQTEESCTQRKDAVERLLRFHVAATTEADTWLDPA
FT                   AAPAEGDRFTGVGEAVRWLDEHRPILIESVRTAIALGSHGLAVRLALGLTRYLELRDRT
FT                   ADRMTVLELAASAAHSAGDRGAEAECRRRLGHIHAQSYSASSALPYYGNAMTLFLLAGD
FT                   GSGAAAVVGDVLALLDRYRARERDTATLIIRYESGLAICRRGGDPAAVAAILDTLGNLH
FT                   QRTGAHHRAADCHAEALVLREQTHDVDGVAESLANLADAQRVGGDGQNAAANYERAAGL
FT                   SRDRGDSRREAQAWENLGLVHLRAGRMRPARQAFEHAAEVFNRGGPAQDAERVRGRLRQ
FT                   LRGWGSRRRAVDAARRQTAHAPDSQGVWRASGEGRHEGSAGTGARRPDRADADVSDVPD
FT                   TDGVIDFAVLWTVADFGLDYGDDTFDDGFGDDSDDSDDFGFDDD"
     gtgctgatgt tgtccggtca ggccggggtg gggaagacgg cgctggcgct gcgtgctgcc        60
     ggggaggcgg tccggcgcca ctggtacgtc aagggcatct acgcggatgt cggccgcgcc       120
     gcggaaactt cggcggagac cgccgtgttc accgcgctgg gcggcctgct gcactcgctg       180
     ggagtgtctg agccgcaggt cgcggcggtg gccgacggcc gcgtggccca gtacaggtcc       240
     gtggtgagcg ccctcgccaa gcggggcaag ccggtgctgg tggtgctgga cagcgtctcc       300
     tcgctcgccg aggcggagcc gctgctgccg ccgcatccac gtaactgcgc ggtcgtcatc       360
     ggccgacacc ggctgacggg tggcgggctt gcgggggcgt gtcatcatgc tctgggcctg       420
     ttcgagccct cggaggccgt cgagttcgtg gtgcgtgcgc tggcggccgc ggacgagcac       480
     gaccgtcggg cggccaccga cccggaggcg gtccgcgcgc tgtcaatggc ctgcggccgg       540
     ctcccgctcg cgctggacct ggccgtgggc cggctggtga cggaccgacg gatgccggtg       600
     ccaacgctgg ccgaccggtt gcaggacacc ccgcggccgt ccgcgccgga aatacaagtg       660
     gaccctgtcc gagcggtatt cgcacggtgc tgcggccgac tgccggccgg acaggcccgg       720
     ctgttgcggc tgctgtcgct gtatcccggt gcgcacttcg gggctgagga ggccgcggcg       780
     ctcggtgggc tgccggttgc cgaggcggcg gacgtgctca tggagctgtc ccgggctcgc       840
     atgctggcgg caagcggacc gaggttcggt ggtcaccgct tccagggcct gctgtggtcc       900
     tacgccaccg atctggccca aaccgaggag tcctgcacac agcgcaagga cgccgtcgag       960
     cggctgctgc ggttccacgt agcggccacc accgaggccg acacgtggct ggacccggcc      1020
     gccgcgcccg cggagggcga ccgcttcacg ggcgttgggg aggccgtccg gtggctggac      1080
     gaacaccgcc cgatcctgat cgagtcggtc cggaccgcga tagccctggg gtcacacggc      1140
     ctggccgtac ggctggccct cgggctgacg aggtatctgg agcttcgcga ccgcaccgcc      1200
     gaccggatga ccgtcctgga actggccgcg tccgcggcgc actcggcggg ggaccggggc      1260
     gcggaggcgg aatgccggcg ccgactgggc cacatccacg cccagtcgta cagtgcttcg      1320
     tccgccctgc cgtactacgg caacgccatg acgctcttcc tgctggccgg tgacggcagc      1380
     ggggccgcgg cggtggtcgg cgacgtgctc gcgcttctcg accgataccg tgcgcgtgag      1440
     cgggacaccg ccactttgat catccggtac gaatcggggc ttgccatctg ccgacgcggc      1500
     ggcgatccgg ccgcggtggc cgccatcctc gacaccctgg gcaacctcca tcagcgcaca      1560
     ggcgctcacc accgggcggc cgactgccac gccgaagccc tggtgctgcg cgagcagacg      1620
     cacgacgtgg acggtgtcgc cgagtcgctg gcgaacctcg ccgacgcgca gcgtgtcggt      1680
     ggcgacggac agaacgccgc ggcgaattac gagcgggccg ccgggctgtc ccgtgaccgg      1740
     ggagacagcc gccgggaggc ccaggcatgg gagaacctcg gcctggtgca cctgcgggcg      1800
     ggtcgcatgc ggcccgcgcg gcaggcgttc gagcacgctg cggaggtctt caaccgcgga      1860
     ggtccggcgc aggacgccga gcgggtacgg ggccgcctgc gtcagctccg cggctggggc      1920
     tctcgccgcc gggccgtcga cgcggcccgg cggcagaccg cccatgcgcc tgacagccag      1980
     ggggtgtggc gcgcgagtgg cgagggtcgc cacgaggggt ccgcggggac gggtgcccga      2040
     cgcccggacc gcgccgacgc cgatgtgtcc gatgtgcccg acacggatgg tgttatcgac      2100
     ttcgccgtgc tgtggaccgt agcggacttc gggctggact acggcgacga cactttcgac      2160
     gacgggttcg gcgacgactc cgacgactcc gacgacttcg gcttcgacga cgactag         2217
//

If you have problems or comments...

PBIL Back to PBIL home page