(data stored in ACNUC7421 zone)

EMBL: CP002047.PE208

CP002047.PE208       Location/Qualifiers
FT   CDS_pept        complement(228380..228997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00208"
FT                   /product="hypothetical protein"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03329"
FT                   /db_xref="GOA:D7BWH3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH3"
FT                   /protein_id="ADI03329.1"
FT                   /translation="MSSYVLPQPRVAIAFHSGYGHTAVLAEAVRRGAEKAGAHVALIPV
FT                   DTITDEQWSELDAADALIFGTPTYMGGASAGFHAFAEATGGRFVDGTWADKIAAGFTNS
FT                   ASKSGDKLNTLTFLSAFAAQHRMIWVTLGLAPGWNALEASEHDLNRLGFWIGAGASTPQ
FT                   DGGIDTVHSSDIATAEHLGARVAERTAVFVAGRAALAGSADA"
     atgtcctcat acgtccttcc gcagccgcgc gtcgcaatcg cctttcactc cggctacggg        60
     cacaccgctg tcctcgccga agcggtacgg cgcggcgccg agaaggccgg tgcgcacgtc       120
     gccctcatcc cggtggacac gatcaccgat gaacagtgga gcgaactcga cgccgccgat       180
     gccttgatct tcggaacgcc tacctacatg ggtggtgcgt ccgccggctt ccacgcgttc       240
     gcagaggcca ccggcggtcg tttcgtcgac ggcacatggg ccgacaagat tgccgccggc       300
     ttcaccaact cggcttcgaa gagcggcgac aagttgaaca cgctgacctt cctctccgcc       360
     ttcgcggcgc agcaccgcat gatttgggta accctcggcc tcgccccggg ctggaacgcc       420
     ctggaggcca gtgagcacga cctcaaccga ctcggcttct ggatcggcgc gggtgcttcg       480
     accccgcaag acggtggaat cgacacggtg cacagctcgg acatcgccac cgctgaacat       540
     ctcggggcgc gcgtcgcgga gcggaccgcg gtgtttgtcg cgggccgtgc cgccctggcg       600
     ggttcggctg acgcttga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page