(data stored in ACNUC7421 zone)

EMBL: CP002047.PE209

CP002047.PE209       Location/Qualifiers
FT   CDS_pept        complement(229452..229688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03330"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH4"
FT                   /protein_id="ADI03330.1"
FT                   /translation="MVKGGDVQDLDGSSRIDYAVVRGRAGFILEEIRGEEDKSGPQKAT
FT                   RMLYGIHDRVLNFTMRRRHQRAESLSDLRQVFL"
     atggtgaagg gtggcgatgt gcaggatctc gacggcagca gccgcatcga ttacgcggtg        60
     gtgcgtggcc gcgccggttt catcctcgag gagatacgag gagaggagga caagagtggg       120
     ccgcagaagg cgacccgtat gctctacggc atacatgatc gggtcctgaa ttttacgatg       180
     cggcggcgcc accaaagagc ggagtctctc tctgacctgc gccaagtctt cctgtag          237
//

If you have problems or comments...

PBIL Back to PBIL home page