(data stored in ACNUC7421 zone)

EMBL: CP002047.PE210

CP002047.PE210       Location/Qualifiers
FT   CDS_pept        229695..231095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00210"
FT                   /product="hypothetical protein"
FT                   /note="COG0142 Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03331"
FT                   /db_xref="GOA:D7BWH5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH5"
FT                   /protein_id="ADI03331.1"
FT                   /translation="MIDDAQVRRGRSTTNAKYGDAIALLTGDYLLARCMQAAASLGASP
FT                   MMSMAETLIDVCVGQMLESSQLFDPLRTEEDYLTAVSGKTARLMRTATTMGALQCNASN
FT                   DVQDALESFGHNLGMAFQIWDDILDICSEETGKQVAKDLLNGVYTLPVIYAIEDFPDRL
FT                   LPTLCEQPLSADRCQEILSLIHESGAISRAADVAQRHVTDALRAVESHPSFVHRAPIIG
FT                   RYLRSLVDRLASQHPALRAQPGTARSGTARSGTARSDSEALPSYGATKALIHDWLNGYI
FT                   TQPNDQLGRDGAVCPFVAPSLRAGSLEIRVRTVGPAPVVGTVIDMVRHALDEFDLIEWE
FT                   GSNPALRSLLVAMPDLAPAECHLLDETHRAVKSAAVRQGMMIGQFHPLCEVPTVRNPEF
FT                   PVNRSPVPLVAIRPMALHDVLFLKDRKEWFEEYHRRFGSHYKPSRGAIEPLLVELFQRA
FT                   CTEHGVGA"
     ttgatcgacg atgcgcaggt caggcgcggg cggtccacca cgaacgcgaa atacggggac        60
     gccatcgcgc tgctcaccgg cgactatctc ctcgcccgct gtatgcaggc cgccgcgtcc       120
     ctcggcgctt cgcccatgat gtccatggct gaaacgctga tcgacgtatg cgtggggcag       180
     atgctcgagt ccagtcagct cttcgaccca ctccgcaccg aagaggatta cctcaccgcc       240
     gtctcgggaa agaccgcgcg cctgatgcgg acggccacca cgatgggcgc cctgcagtgc       300
     aatgcgagca acgacgtcca ggacgcgctg gagagtttcg gtcacaatct cggcatggcg       360
     tttcagatct gggacgacat cctcgacatc tgcagcgagg aaaccggaaa gcaagtcgcg       420
     aaggatctgc tcaacggcgt gtacacactc ccggtgatct atgccatcga ggatttcccg       480
     gatcgcttgc ttccgacatt gtgcgagcag ccactctccg ccgaccggtg ccaggaaatt       540
     ctttccctca tccatgagtc cggagcgatc agtcgggctg cggatgtggc acagcggcat       600
     gtgacggacg cgctgcgcgc tgtggagtca catccgtcct ttgtccatcg agcgccgatc       660
     atcgggcgct atttgcgcag cctcgtcgac cggctcgcat cccagcatcc cgcactccgg       720
     gcgcagcccg gcaccgctcg ttccggcacc gcccgttccg gcaccgctcg ttccgactcg       780
     gaggcccttc cgtcgtacgg tgcgacgaag gcgctgatcc acgactggct gaacggatac       840
     atcacccagc cgaacgatca gcttggacga gacggggccg tgtgcccgtt cgtggcgccg       900
     tcgctgcggg cggggtcact ggagattcgg gtgcggacgg tggggccggc ccccgtcgtc       960
     gggaccgtca tcgacatggt ccgccacgcg ctcgacgagt tcgatctgat cgagtgggaa      1020
     ggctcgaacc cggcgttacg gagcctgctc gtggccatgc ccgatctggc gccggccgaa      1080
     tgtcatctac tcgacgaaac acatcgggcg gtcaagtcgg cggcggtgcg tcagggcatg      1140
     atgatcggtc aattccatcc tctgtgcgag gtgccgaccg tcagaaatcc cgagtttccg      1200
     gtcaatcgct caccggtgcc gctggtggcg atccggccca tggccttgca cgacgttctg      1260
     ttcctcaaag accggaagga atggttcgag gagtatcacc ggcgcttcgg cagtcattac      1320
     aagcccagca ggggtgccat agagccgctg ctcgtcgagc tgtttcagcg cgcatgtacg      1380
     gaacacgggg tcggcgcatg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page