(data stored in ACNUC7421 zone)

EMBL: CP002047.PE211

CP002047.PE211       Location/Qualifiers
FT   CDS_pept        231092..231946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00211"
FT                   /product="hypothetical protein"
FT                   /note="COG0657 Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03332"
FT                   /db_xref="GOA:D7BWH6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH6"
FT                   /protein_id="ADI03332.1"
FT                   /translation="MSNGNGYRGFSRADLDREYSPSSVVPSLPFYLNEYATLSAAAHNE
FT                   HTPLTDLRYSASPEARLDLFPVEGGASALEVFVHGGYWQDVTKEQSAFAAPDFVAEGIA
FT                   FAALDYGLAPAYSLDEIVTMVCEAVAWLHANAPRFGIDPQRIHLSGSSAGAHLVAMALI
FT                   RDDAQRIAGATLLSGIYDLEPLRHTYVNGALGLDADAALRNSPIHHLPERLPPIVIARG
FT                   GGETGEFIRQHDTMAALLRRRNAVTELVCPTRNHFDLPYDLGNQHTALGKAVLTRIDDI
FT                   EEG"
     atgagcaacg gcaacggcta caggggcttc agccgcgcgg atctcgaccg ggagtattcc        60
     cccagctccg tcgtcccgag cctgccgttc tatctgaacg agtacgccac cctcagcgcc       120
     gccgcgcata acgagcacac cccgctcacc gacctccgct acagcgcgtc tcccgaagcg       180
     cggctcgatc tgttccccgt ggagggcggc gcatcggccc ttgaggtgtt cgtacacggc       240
     ggttactggc aggacgtcac gaaggagcag tcggccttcg cggccccgga cttcgtcgcc       300
     gagggcatcg cgttcgcggc gctcgactac gggttggcgc ccgcttactc cctggatgag       360
     atcgtcacga tggtgtgtga ggccgtggca tggctccacg ccaacgcccc tcgcttcgga       420
     atcgaccccc agcggatcca tctcagcgga agctccgcgg gcgcacacct cgtggcgatg       480
     gcgctcatcc gggacgacgc acaacggatc gcaggcgcca ctctgctgag cggtatctat       540
     gacctggagc cgctgcgcca tacgtacgtg aacggcgccc tggggctgga tgccgatgcc       600
     gcgctgcgca acagcccgat ccatcatctg cccgagcggc ttccgccgat cgtcatcgcg       660
     cgcggcgggg gtgaaacggg ggagttcatc cgccagcacg acaccatggc ggccttgcta       720
     cggcggcgca acgcggtcac cgagctcgta tgcccgacgc gcaaccactt cgacctcccc       780
     tacgacctgg ggaatcagca caccgcgctc ggcaaggccg tgctgacgcg catcgatgac       840
     atcgaggagg gatag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page