(data stored in ACNUC7421 zone)

EMBL: CP002047.PE214

CP002047.PE214       Location/Qualifiers
FT   CDS_pept        234067..235137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00214"
FT                   /product="O-methyltransferase family protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03335"
FT                   /db_xref="GOA:D7BWH9"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWH9"
FT                   /protein_id="ADI03335.1"
FT                   /translation="MTAKSPLTKDDLVGILFGAGAFQMLHAGCELGLFRLLRRRPALSP
FT                   SQVAKELGLHARPVQILLLGTTALGLTARTDGRYRNGELVEELFQEGTWDIIEDLAEFQ
FT                   QKVTGPAALDFVASLRQNTNVGLRHIPGDGDDLYRRLTGHPQLSQLFYRCMKSWSTLSN
FT                   PILVENADLSGVGNVLDVGGGDGVNSIALAMANPGVAFTVFDLPGTAAIAQHKIRLQGL
FT                   SDRVGVVEGDMFADPFPTGHDCLLFANQLVIWSPEENRSLLRKAYEALPDGGRVLIFSA
FT                   MSDDTGDGPLYAALDNVYFATLPTGNSMIYHWAQYEEWLAEAGFCEVVRLPGKTWTPHG
FT                   LIAARKRMPSAPGGVK"
     gtgaccgcca agagcccact gacgaaggac gacctggtcg gcatcctgtt cggcgcgggc        60
     gcgttccaga tgctgcacgc cggctgtgag ctggggctgt tcaggctgtt gcggcgacgc       120
     cccgcgctgt ccccgtcgca ggtggcaaag gaactgggcc tgcacgcgcg gccggttcag       180
     atcctgctgc tcggcacgac cgcgctcggc ctgaccgccc ggacggacgg ccggtaccgc       240
     aacggcgagc tggtcgaaga gctgttccag gagggcacct gggacatcat cgaggacctt       300
     gccgagttcc agcagaaggt caccggcccc gccgccctcg atttcgtggc gtcgctgcga       360
     cagaacacca atgtcgggct gcgccacatc cccggcgacg gcgacgatct gtaccggcgg       420
     ctgaccggcc acccccagct gtcacagctc ttctaccgct gtatgaagtc ctggtcgacg       480
     ctgtcgaatc cgatcctggt ggagaacgcc gatctctccg gggtcggaaa cgtcctcgac       540
     gtcggcggcg gtgacggtgt gaactcgatc gcgctggcca tggccaaccc cggtgtcgcg       600
     ttcaccgtct tcgatctgcc cgggacggcg gccatcgcac agcacaagat ccggctccag       660
     ggtctgagtg accgcgtcgg cgtcgtcgag ggcgatatgt tcgccgatcc cttcccgacg       720
     ggacacgact gtctgctctt cgccaaccag ctcgtcatct ggtcgcccga ggagaaccgc       780
     tcgctgctgc gcaaggccta tgaggcgctg ccggacggcg ggcgggtgct gattttcagc       840
     gcgatgtccg atgacaccgg ggacggcccg ctgtacgccg cgctcgacaa cgtctacttc       900
     gccacgctgc cgacggggaa cagcatgatc taccactggg cgcagtacga agagtggctg       960
     gccgaagccg ggttctgcga ggtggtgcgg ctgcccggga agacctggac tccgcacggc      1020
     ctgatcgcgg cgaggaaacg tatgcccagc gcacccggag gggtgaaatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page