(data stored in ACNUC7421 zone)

EMBL: CP002047.PE219

CP002047.PE219       Location/Qualifiers
FT   CDS_pept        239330..239755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03340"
FT                   /db_xref="GOA:D7BWI4"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI4"
FT                   /protein_id="ADI03340.1"
FT                   /translation="MRGRDRALCLFYGLFTVGGFLVMASMAVAYVLNHRENGPSGVVRD
FT                   FLRDAVTNAASRFIYADLTLVWIALAGFMVVEARRLGIRYVWSYIIGAPVLALCVSFPL
FT                   FMFIRQLKIASAAKGAPSPSPSVRLSAGLQEKGSDDH"
     gtgcgcggca gggatcgcgc gctgtgcctg ttctacgggt tgttcaccgt cggtggcttc        60
     ctcgtcatgg cttcgatggc cgtcgcctac gtgctgaatc accgtgagaa cggtccatcc       120
     ggcgtcgtcc gggattttct gcgcgatgcg gtgaccaatg cggcgtcccg gttcatctac       180
     gcggatctga cgctcgtatg gatcgcactc gcggggttca tggtcgtcga agcacggcgg       240
     ctcggaatcc ggtacgtgtg gtcgtacatc atcggcgccc cggtgctggc gctgtgcgtg       300
     agcttcccgc tcttcatgtt catccgccag ttgaagatcg cgtccgcggc gaagggcgcc       360
     ccaagcccaa gcccatccgt acggctgtcc gcgggattac aagagaaagg cagcgatgac       420
     cactga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page