(data stored in ACNUC7421 zone)

EMBL: CP002047.PE22

CP002047.PE22        Location/Qualifiers
FT   CDS_pept        20147..20485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00022"
FT                   /product="hypothetical protein"
FT                   /note="COG3795 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03143"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW6"
FT                   /protein_id="ADI03143.1"
FT                   /translation="MTRYLISFDDGAMTFPEEELPEVAEASLEVVRKARDAAVWVFGGG
FT                   LERQQASVVSTDGTVTNGPYPETKAVLGGFAIIDVPSREDALEWAAKIAAACRCAQEVR
FT                   EIMADPTV"
     atgacgcggt acctgatctc ttttgatgac ggcgcgatga ccttccccga ggaggagttg        60
     cccgaggtgg ccgaggcctc gctcgaggtg gtacgtaagg ctcgggacgc cgctgtgtgg       120
     gtcttcggtg gtggactgga aaggcagcag gcgagcgtcg tgtccaccga cgggaccgtc       180
     accaacggcc cgtacccgga gaccaaggcg gtgctcggcg ggtttgcgat catcgatgtg       240
     ccctcacgtg aggacgcatt ggagtgggct gccaagatcg ctgccgcgtg ccgctgcgcg       300
     caagaggtcc gggagatcat ggccgacccg accgtctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page