(data stored in ACNUC7421 zone)

EMBL: CP002047.PE221

CP002047.PE221       Location/Qualifiers
FT   CDS_pept        241685..243181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00221"
FT                   /product="hypothetical protein"
FT                   /note="COG3349 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03342"
FT                   /db_xref="GOA:D7BWI6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI6"
FT                   /protein_id="ADI03342.1"
FT                   /translation="MTGVTVIGGGLAGMTAAWTIRKLGVPVRLLEAAPELGGMAGSRVI
FT                   GNRVEDHGVHIFPAWYGNALRLVEELSIVDNLRECDNFYQLMPGEFPTFRTFRSLFTLG
FT                   DFVKDIRSGVTPAADRLLFYYGLIDLLAQRYEGRDESLHGFLHSRWYLTDTAIADIEHL
FT                   FVASSAAESQAASAASFRGSIAAFSRQPGRVRMPKGDLDTWFIGPFRRRLEADGVEVRT
FT                   GVELLEVSVDGDRLGTITLCDGDTVIEEVNGHVVLAVPHGRLSGLGRAVTRALRPPHGV
FT                   DELCSRPLGALHVYLRRRLPGLPDEHIRLVGSRHAITLIDVGQVWEGHRTTLLNCVVGR
FT                   VARLAELSEAEAVKVLVEELMGYLPVLTWDDIEHVCYQPHFAEPFFAPGPGSDQYRPVS
FT                   STALANLHIAGDFCAAPAGVAGMEGAVRSGLAAAESVRRALRPDAPRVRIDDIGTVSPS
FT                   AARGLRVALAPVAAAVRLLAKRPRGRGAAATAGHDLDGQP"
     atgaccggtg tgaccgtgat cggaggtggc ctcgccggga tgacggcggc gtggaccatc        60
     cgcaagctcg gagtgccggt gcggctgctg gaagccgcac cggaactcgg cggaatggcc       120
     gggtcacgag tgatcggcaa ccgggtcgag gaccacgggg tgcatatctt ccccgcctgg       180
     tacggcaatg cgctccgcct cgtcgaagag ctgagcatcg tcgacaacct gcgcgagtgc       240
     gacaacttct accagttgat gccgggtgag ttccccacct tccgcacctt ccgctcgctc       300
     ttcaccctgg gggacttcgt caaggacatc cgctcggggg tcacaccggc cgccgaccgg       360
     ctgctgttct actacgggct gatcgatctg ctcgcccagc gatacgaagg ccgcgacgaa       420
     tccctccacg gctttctcca cagccgctgg tatctgaccg acacggccat cgccgacatc       480
     gagcacctgt tcgtcgcgtc cagcgccgcg gagagccaag cggcgtcggc ggcgagcttc       540
     cgcggcagca tcgccgcgtt ctcccggcag cccggtcgcg tacggatgcc gaagggcgat       600
     ctggacacct ggttcatcgg ccccttccgt cggcgcctgg aagccgatgg tgtcgaggtc       660
     cgcaccggtg tggaactgct cgaggtctcc gtggacggag accgtctggg caccatcacc       720
     ttgtgtgatg gggacacggt gatcgaggag gtcaacggcc acgtcgtgct ggcagtcccg       780
     catgggcgtc tgtccgggct cggccgcgcc gtcacccgtg cgctgcgacc gccccatggg       840
     gtcgatgagc tgtgctcccg tccgctcggg gcgctgcacg tatatctgcg gcggcggttg       900
     ccgggactgc cggacgagca catacgtctg gtcggctcgc gtcacgccat caccctcatc       960
     gacgtcggtc aggtctggga aggacaccgc accaccctcc tcaactgcgt ggtcggccgt      1020
     gtcgcgcggc tcgcggagct gtccgaagcc gaggcggtca aggtcctggt ggaggagctg      1080
     atgggctatc tgccggtgct cacctgggac gacatcgaac acgtctgcta tcagccgcac      1140
     ttcgcggagc cgttcttcgc cccggggccc ggttccgatc agtaccggcc ggtgagctcg      1200
     accgcactgg ccaatctgca tatcgccggg gacttctgcg ccgccccggc gggtgtggcc      1260
     ggtatggaag gcgcggtccg atcggggctg gccgccgccg aatcggtccg tcgggcgctg      1320
     cgccccgacg ccccgcgggt gcggatcgac gacatcggca cggtcagccc ctcggccgcc      1380
     cgcggcctcc gggtggcgct cgccccggtc gccgcggccg tccggttgct ggccaagcgc      1440
     ccacgcggac gcggggcggc ggccaccgcc ggacacgacc tcgacgggca accgtaa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page