(data stored in ACNUC7421 zone)

EMBL: CP002047.PE223

CP002047.PE223       Location/Qualifiers
FT   CDS_pept        complement(244588..244785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03344"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI8"
FT                   /protein_id="ADI03344.1"
FT                   /translation="MANLPEDIVDRIRALERQVHRLTTYVNSKPGTMPAALAAAEPPPP
FT                   SAQEDPADEPPPPSPASGNP"
     atggcgaacc tgcccgagga catcgtggac cggatcaggg ccctggaacg gcaggtccac        60
     cggctcacca cgtacgtcaa cagcaagccc ggcacgatgc cggcggccct ggcggcagcg       120
     gagccgccgc caccctccgc ccaggaggac cccgcggacg agccgccgcc accttctcct       180
     gcgtcaggga acccgtga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page