(data stored in ACNUC7421 zone)

EMBL: CP002047.PE224

CP002047.PE224       Location/Qualifiers
FT   CDS_pept        complement(244785..245873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03345"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWI9"
FT                   /protein_id="ADI03345.1"
FT                   /translation="MDARYRAVFTDLRTDQAIDVLPLQGVEYDDYLGKPGSLSATLPVP
FT                   DARMARRVRELVEGRTAVYLERGDEVCWGGIVWTLTPATDDRGSTTVGLQAATFDSYAG
FT                   RRYIRANLNFSAVDHLEIVRGLWEYMQGAEGGRIGVEYETTAPTTSRTVAYRDGDETLV
FT                   EEAIGQLAAMEPGFEYRIAVYRDPVTGRRVKLLQLGSPKIQAGSQPVMLDLPGDVLSYA
FT                   FPRDATRGGTTTRARGGTPGGGASGPVLSGEQVAQDLIAAGFPRLDTTSDHSNVTDRAT
FT                   LDAFARSELAALRGPVVIPSVRIRLGSDTTPALLGTTVRLRIKDVWFSEGLDARYRVVG
FT                   IKVTAPERGRPETADLYLEETD"
     gtggacgccc gctaccgcgc cgtgttcacc gatctgcgca ccgaccaggc catcgatgtg        60
     ctgcccctgc aaggcgtgga gtacgacgac tacctcggca aacccggatc gctcagcgcg       120
     accctgccgg tgcccgacgc ccggatggcc cggcgtgtcc gggagttggt ggaggggcgc       180
     accgccgtct atctggagcg tggggacgag gtgtgctggg gcggcatcgt atggaccctg       240
     accccggcca cggacgaccg gggcagcacg acggtcgggc tgcaggcggc cactttcgac       300
     tcgtacgcgg gccgccgcta catccgcgcg aacctgaact tctccgcggt cgaccatctg       360
     gagatcgtcc gtgggctgtg ggagtacatg cagggggccg agggcggccg gatcggggtg       420
     gagtacgaga cgacggcccc gaccacctcc cgtacggtgg cctaccgcga cggggacgag       480
     accctggtgg aagaggcgat cgggcaactg gcggcgatgg agcccggctt cgagtaccgg       540
     atcgcggtgt accgggatcc ggtgacgggg cgccgggtga agctgctcca gctcggctcg       600
     ccgaagatcc aggcgggcag ccagcccgtg atgctggatc tgccgggtga tgtgctgtcg       660
     tacgccttcc cccgcgacgc cacgcgcggc gggacgacca cgcgggccag gggcggtacc       720
     ccggggggcg gggcgagcgg tccggtcctg tccggggaac aggtggcgca ggacctgatc       780
     gcggccgggt tcccccggct ggacaccacc tccgaccaca gcaacgtcac cgacagggcg       840
     acgctcgacg cgttcgcccg ctccgaactc gccgccctgc gcggcccggt ggtcatcccc       900
     tcggtccgga tccgtctcgg ctccgacacc acgcccgcgc tgctcggcac gaccgtgcgg       960
     ctgcgcatca aggacgtgtg gttctccgag ggcctggacg cccgctatcg cgtggtcggc      1020
     atcaaggtca ccgcccccga gcgggggcgc ccggagaccg ccgatctgta tctggaggag      1080
     acagactga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page