(data stored in ACNUC7421 zone)

EMBL: CP002047.PE225

CP002047.PE225       Location/Qualifiers
FT   CDS_pept        complement(245879..246922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03346"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ0"
FT                   /protein_id="ADI03346.1"
FT                   /translation="MTVRSAWHLPTGQTREDTRLAVGLGMASAGPLLTRAGCVFGGLQL
FT                   AGTAAAGMQAKLSPGQVWIAGTSTGSQGGYPVTVDSDTLLTITDGHASLPRVDALVVRV
FT                   YDNDYDGLGRYEATLELLQGTPAGSPTAPAVPKNTELLYEIAVPAGASAAKGITWASAI
FT                   TDRRRYTAALGGIVPAAGGAPHNGAYVGQYRDVGGRLERWDGVQWTKFIPNAVLMHTAD
FT                   WGGTTSTSYVEVLPIDTTAPLVATFTAPASRWVSLTFGAFTGADGDATAYISFRIRLQS
FT                   GTEVLAPSDDRAAILVGAGKASISTCFPVGNLTPGAVYTATAAYRSSVAGTRVHFDSRF
FT                   IRVDPVA"
     atgaccgttc gttccgcctg gcatctgccc accggccaga cccgcgagga cacccggctc        60
     gccgtcggcc tcggcatggc gtccgccggg ccgctgctga cccgcgccgg gtgcgtgttc       120
     ggcgggctgc agctcgccgg caccgccgcc gccggcatgc aggccaaact ctctcccggg       180
     caggtgtgga tcgcgggcac gtccaccggc tcgcagggtg gctacccggt caccgtcgac       240
     tccgacaccc tgctgaccat cactgacggg cacgccagcc tgccgcgcgt ggacgcgctg       300
     gtcgtacggg tctacgacaa cgactacgac ggcctcggca ggtacgaggc caccctggag       360
     ctcctgcagg gcaccccggc cggttccccc accgcccctg ccgtgcccaa gaacaccgaa       420
     ctcctctacg agatcgccgt tcccgccggg gcgtccgccg ccaagggcat cacctgggcc       480
     tccgccatca ccgaccgccg ccgctacacc gcggcactgg gcggtatcgt ccccgcggcg       540
     ggcggggcgc cgcacaacgg ggcgtacgtc gggcagtacc gtgacgtggg cggccggctg       600
     gagcgctggg acggcgtcca gtggacgaag ttcattccga acgcggtgct gatgcacacc       660
     gcggactggg gcggcaccac ctccacctcg tatgtcgaag tccttcccat cgacaccacc       720
     gcccccctcg tcgccacctt caccgcgccg gcctcgcggt gggtgtccct caccttcggt       780
     gccttcacgg gcgccgatgg ggacgccacc gcgtacatct ccttcaggat caggctgcag       840
     agcggcaccg aagtgctcgc tccctccgac gaccgcgcgg cgatcctcgt cggcgcgggc       900
     aaggcatcca tctccacctg cttcccggtg ggcaacctca cccccggcgc cgtctacacc       960
     gcgaccgccg cctaccggtc ctccgtcgcc gggacgcgtg tgcacttcga cagccgtttc      1020
     atccgcgtcg accccgtggc atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page