(data stored in ACNUC7421 zone)

EMBL: CP002047.PE226

CP002047.PE226       Location/Qualifiers
FT   CDS_pept        complement(247020..247943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03347"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ1"
FT                   /protein_id="ADI03347.1"
FT                   /translation="MASETTTAAAEPGPLITADGQVQWAGLLMGPGTDYWIAAEGLTGW
FT                   EELPALDTSDADRPVGHGGWPGSQWAQARTVTAQVWFAPDPDSGPEGVREALRALRAAT
FT                   AVRDEEEWLAVRLHGETLAVRARVTQRVVPTDRQFAASRLAKMTLQWKASDPRRYEAVG
FT                   RRDTVGLPQREPGLTWPLVWPLVWGAPGATGDLTVENDGSAPAHPVITFTGPCTRPRLA
FT                   NRAGGDWLEYAIALAPDDELVVDTAEGTVMFNGTASRRHTAVPGSAPEESFTLPPGTSQ
FT                   LSFRAASGGGGGAPPPATIAWRRAEW"
     atggcgagcg agaccaccac cgccgccgcc gagccgggac cgctgatcac ggccgatggg        60
     caggtgcagt gggccgggct gctgatgggc cccggcaccg actactggat cgccgcagag       120
     ggactgaccg gctgggagga gttgcccgcc ctggacacct ccgacgccga ccgcccggtc       180
     ggccacggcg gctggccggg ttcgcagtgg gcgcaggccc gtacggtcac cgcgcaggtg       240
     tggttcgcgc cggacccgga ctccgggccc gagggtgtac gggaggccct gcgcgcgctg       300
     cgcgcggcca ccgccgtgcg cgacgaggag gaatggctgg cggtgcggtt gcacggcgag       360
     acgctggcgg tgcgggcccg ggtcacccag cgcgtcgtcc ccaccgaccg gcagttcgcg       420
     gcgagccgcc tggcgaagat gacgctccag tggaaggcca gcgatccgcg ccgctacgag       480
     gcggtggggc ggcgcgacac cgtcggcctc ccgcagcggg aaccgggcct gacctggccg       540
     ctcgtatggc cgcttgtctg gggtgcgccc ggtgccacgg gcgacctcac cgtggagaac       600
     gacggcagcg cccccgccca tccggtgatc accttcaccg ggccgtgcac ccggccgcgc       660
     ctggccaacc gggccggcgg cgactggctg gagtacgcga tcgccctggc cccggacgac       720
     gaactcgtcg tggacaccgc cgaggggacc gtgatgttca acggcaccgc gtcgcgccgc       780
     cacaccgccg tcccgggaag cgctccggag gagtcgttca ccttgccgcc cggcacctcg       840
     cagctgtcgt tccgggccgc gtcggggggg gggggggggg cccccccccc cgccacgatc       900
     gcctggcggc gcgcggagtg gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page