(data stored in ACNUC7421 zone)

EMBL: CP002047.PE227

CP002047.PE227       Location/Qualifiers
FT   CDS_pept        complement(247945..249102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00227"
FT                   /product="hypothetical protein"
FT                   /note="COG5412 Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03348"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ2"
FT                   /protein_id="ADI03348.1"
FT                   /translation="MSLLAALNRSSSALLRLKNGTGQTDTTVSKFARTATQAGGAVGRI
FT                   KDDVDKSANSMRTLQREANAAERSVAKSGRSMTTAGRGAATGGGLMGRMKTGLQGVTTA
FT                   QKGLNTAMKSNVFGAVMALLMPLIMKLVDMAMQSKTVQRIVQAAFRIVGQVIGSTMRVA
FT                   KQVVQATWDAIKVAFTVVLKVIWTVVKTYFNIYKTIITTVIHAIMAVIRPLLSFFSEKI
FT                   PAAFRATRNGIQHAFSGLAGVVRGAFSAVLGAVRGPLNGVIGLVNRAIGALNRVKVSVP
FT                   SWVPGIGGKSFGVNLPTIPTLAQGGIVLPRPGGTLALLAEAGQAEAVLPLNRLNALLAR
FT                   TGPAPGLAIAGKPGGGFVIEHYHEAPGASARQTAEDLMFLMKARG"
     atgtcactgc tcgctgcact caacaggtcc tcgtccgcgc tgctgaggct gaagaacggc        60
     accggccaga ccgataccac cgtctccaag ttcgcccgga ccgcgaccca ggccggcggc       120
     gccgtgggcc gtatcaagga cgacgtcgac aagtcggcca actccatgcg caccctgcag       180
     cgagaagcca acgccgccga gcgcagtgtc gccaagagcg gccgttccat gaccaccgcg       240
     ggccgcggcg cggcgaccgg cggggggctg atggggcgga tgaagacggg gctccagggg       300
     gtgaccacgg cccagaaggg cctgaacacc gccatgaagt cgaatgtctt cggggctgtc       360
     atggcgctgc tgatgccgct gatcatgaag cttgtcgaca tggccatgca gtccaagacg       420
     gtccagcgca tcgtccaggc tgccttcagg atcgtcggcc aggtcatcgg cagcacgatg       480
     cgggtggcga aacaggtggt gcaggcgacc tgggatgcca tcaaggtggc gttcacggtc       540
     gtgctgaagg tcatctggac cgtggtgaag acctacttca acatctacaa gaccatcatc       600
     accacggtga tccacgccat catggccgtg atccgcccgc tgctgtcctt cttctcggag       660
     aagatcccgg ccgcgttccg ggccaccagg aacggcatcc agcacgcgtt cagcgggctg       720
     gccggggtcg tacggggcgc gttcagtgcc gtgctcggcg ccgtgcgggg gccgctgaac       780
     ggggtgatcg ggctggtcaa ccgggcgatc ggggcgctga accgggtcaa ggtgtcggtc       840
     ccctcctggg tgccggggat cggcggcaag tcgttcgggg tgaacctgcc caccatcccc       900
     acactcgccc agggcggcat cgtgctgccc cgccccggag gcaccctcgc gctgctcgcc       960
     gaggccgggc aggccgaagc cgtactgccg ctgaaccggc tgaacgccct gctggcccgc      1020
     accgggcccg cgcccgggct cgccatcgcg ggcaaaccgg gtggcgggtt cgtcatcgag      1080
     cactaccacg aggccccggg cgccagtgcc cggcagaccg ccgaggatct gatgttcctg      1140
     atgaaggcga gggggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page