(data stored in ACNUC7421 zone)

EMBL: CP002047.PE229

CP002047.PE229       Location/Qualifiers
FT   CDS_pept        complement(249739..250128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03350"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ4"
FT                   /protein_id="ADI03350.1"
FT                   /translation="MEEHAEALEADLLRYYGVDLLDWHRETLSSRRLSVLVRHLPPDSA
FT                   FVRAREGEAAEWRLTDHLLAAVVDHLAIANWMYASVNRDEYADPPEAPVPVPRPGAGAA
FT                   GASDAPGPAATDRAPTAAELARFFG"
     gtggaggagc acgccgaggc gctggaggct gatctgctgc ggtactacgg cgtcgatctg        60
     ctcgactggc accgggagac gctgtcctcg cggcggctgt cggtcctggt ccgccatctg       120
     ccgccggact cggcgttcgt acgggcccgg gagggcgagg ccgcggagtg gcggctgacg       180
     gaccatctgc tggcggcggt ggtcgaccac ctcgcgatcg ccaactggat gtacgcgtcg       240
     gtcaaccgcg acgagtacgc ggacccgccg gaggcgccgg tgccggtgcc ccggccgggc       300
     gcgggggccg cgggagcatc cgacgcgccg gggccggccg ccactgaccg tgcgccgacc       360
     gcggcggagc tggcgcggtt cttcggttga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page