(data stored in ACNUC7421 zone)

EMBL: CP002047.PE230

CP002047.PE230       Location/Qualifiers
FT   CDS_pept        complement(250143..250433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03351"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ5"
FT                   /protein_id="ADI03351.1"
FT                   /translation="MPPFNVNAARAQRLEALGQTWDFEVDGETFSLPTEIPRRSAHALA
FT                   ELKDNDLDGLLALLMGEESYQRLCEHEVSVQDIAAILEAYGQDTGLGVGEG"
     atgcccccgt tcaatgtcaa cgccgcacgc gcccagcgtc tcgaagccct cggccagacc        60
     tgggacttcg aggtcgacgg ggagacgttc tccctgccca ccgagatccc ccgccgctcg       120
     gcgcacgccc tcgccgagct caaggacaac gacctggacg ggctgctcgc cctgctcatg       180
     ggggaggaga gctaccagcg gctgtgcgaa cacgaggtga gcgtgcagga catcgccgcg       240
     atcctcgagg cgtacggcca ggacaccggg ctcggcgtgg gggaaggctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page