(data stored in ACNUC7421 zone)

EMBL: CP002047.PE231

CP002047.PE231       Location/Qualifiers
FT   CDS_pept        complement(250504..251079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00231"
FT                   /product="hypothetical protein"
FT                   /note="COG4147 Predicted symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03352"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWJ6"
FT                   /protein_id="ADI03352.1"
FT                   /translation="MPGMNPNEIRVAGTGRILTAPLGTTVPADVSTAWAAAWKDLGYTS
FT                   TDGIKFNKKDKIDPVDTWQSVSPARFVYSDRDLTVKFQLLQLNEDTLPFFFGGDAVTET
FT                   AAGSKVYRYELDSEPKKDERMLGVEFADGDVIKYRFIIRRGQVTETEELQLTRTAAVRL
FT                   GVTFTALAVDNDTPLATWLMNDPAFAGS"
     atgcccggaa tgaaccccaa cgagatccgt gtagcgggga ccggccgcat cctgaccgcc        60
     ccgctcggca ccaccgtccc ggccgacgtg tccacggcgt gggcggcggc ctggaaggac       120
     ctcgggtaca ccagcaccga cggcatcaag ttcaacaaga aggacaagat cgacccggtg       180
     gacacctggc agtcggtcag cccggcccgc ttcgtctact ccgaccgcga cctgaccgtg       240
     aagttccagc tgctccagct caacgaggac accctgccgt tcttcttcgg cggcgacgcg       300
     gtgacggaga ccgcggccgg ctccaaggtg taccgctatg aactcgactc cgagccgaag       360
     aaggacgagc ggatgctcgg cgtcgagttc gcggacggcg atgtcatcaa gtaccgcttc       420
     atcatccgca ggggccaggt caccgagaca gaagagctcc agctcacccg cacggccgca       480
     gtccgcctcg gcgtcacctt caccgccctg gccgtggaca acgacacccc actggccacc       540
     tggctgatga acgacccggc cttcgccggg tcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page