(data stored in ACNUC7421 zone)

EMBL: CP002047.PE235

CP002047.PE235       Location/Qualifiers
FT   CDS_pept        252750..252968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03356"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK0"
FT                   /protein_id="ADI03356.1"
FT                   /translation="MHGHKAPEETERDAVLTVAERLKAVYAGRCAPEEIDAAVATAYAA
FT                   LRDRPVRAFIPVLVERRVRRMLKGPAN"
     atgcatggac acaaagctcc cgaggaaacg gagcgcgacg ccgtcctgac ggtcgccgaa        60
     cggctgaagg ccgtatacgc gggcaggtgt gctccggagg agatcgatgc cgccgtggcc       120
     acggcgtacg ccgcgttgcg cgaccggccg gtgcgcgcgt tcattccggt cctcgtggag       180
     cgcagggtac gccgcatgtt gaaaggcccc gccaactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page