(data stored in ACNUC7421 zone)

EMBL: CP002047.PE239

CP002047.PE239       Location/Qualifiers
FT   CDS_pept        complement(258872..260365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00239"
FT                   /product="putative transmembrane protein"
FT                   /note="COG1457 Purine-cytosine permease and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03360"
FT                   /db_xref="GOA:D7BWK4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK4"
FT                   /protein_id="ADI03360.1"
FT                   /translation="MAASEKDRVGSVETRGIEPVPDTERHGHAGQMFWTWFAANISILG
FT                   LPLGAALVSFRGLNIWQAAVVAVLGSFGSFALVGALSIAGKRGGAPALTLSRAVFGVRG
FT                   NAGPTLVTWMSRLGWETINTTTAAFALLALLDVAFGIRRNTVLTVICLLVFIGCTLLIS
FT                   GLGHATIMWINRWASYVFGLLNLVVIGFLAATVDWGKVGHAPAGPVSAMVVGVGMIAAG
FT                   TGIGWANTGADYARYLPRRIPGGRLVAASAFGAGIPLVVLISLGSLLAAGEPDLASASD
FT                   PVSAINAMLPTWMSIPYLIAAFGGLLLSNHLSVYSAGLTMITLGIRVRRTLAVGLDVIV
FT                   TFAGGIYFILIAKDFYGPFITFLTLLAVPINAWVGVFAVDLIVRRSYDSAALMDVGRSS
FT                   RYWFRGGVAWAAMIAWAMAIVVGLLFTEASTSPTDVWFSGPLAHSWIGSNGLGWVVTLT
FT                   LSATVYALLRRLDGTVRQEAAGQRPQQQVLSAPATREIS"
     atggcggctt cagagaaaga ccgcgtcggc tccgtggaga cccgtggcat cgagccggtt        60
     ccggacaccg agcgccacgg ccacgccgga cagatgttct ggacctggtt cgccgcgaac       120
     atcagcatcc tcggcctgcc gctcggcgcg gctctggtca gcttccgcgg cctgaacatc       180
     tggcaggcgg ccgtcgtggc cgtgctcggg tccttcggct ccttcgccct ggtgggcgca       240
     ctcagcatcg ccggtaagcg gggcggggcg cccgccctca cgctgtcccg ggcggtgttc       300
     ggggtccgtg gcaacgcggg ccccacgctg gtcacctgga tgagccggct cggctgggag       360
     accatcaaca ccaccacggc cgccttcgcc ctgctggcgc tgctcgacgt cgcgttcggc       420
     atccggcgca acaccgtgct caccgtgatc tgtctgctgg tcttcatcgg ctgcactctg       480
     ctgatcagcg gcctcggaca cgccaccatc atgtggatca acagatgggc cagctatgtc       540
     ttcggcctgc tcaacctggt ggtgatcggt tttctcgcgg ccaccgtcga ctggggcaag       600
     gtgggccacg cgccggccgg tccggtgagt gcgatggtcg tgggcgtcgg catgatcgct       660
     gccgggaccg ggatcggctg ggccaacacc ggcgccgact acgcccgtta tctgccccgg       720
     cggatccccg gcgggcggct cgtggccgcg tccgcgttcg gcgccggtat tccgctggtc       780
     gtgctgatct cgctgggctc actgctcgcg gcgggtgagc cggatctcgc ctccgcctcc       840
     gatccggtct cggccatcaa cgcgatgctg cccacctgga tgtccatccc gtatctgatc       900
     gccgccttcg gcgggctgct gctctccaac cacctgtccg tctactcggc cggactcacc       960
     atgatcaccc tgggcatacg ggtccgacgc accctcgccg tcggcctgga cgtgatcgtc      1020
     accttcgcgg gcgggatcta cttcatcctg atcgccaagg acttctacgg cccgttcatc      1080
     accttcctca cccttctcgc cgtgccgatc aacgcctggg tgggcgtctt cgccgtcgac      1140
     ctcatcgtcc gccggtcgta cgacagcgcg gccctgatgg acgtcggccg ctccagccgc      1200
     tactggttcc ggggcggggt cgcctgggcc gcgatgatcg cctgggcgat ggccatcgtg      1260
     gtgggcctgc tgttcacgga ggcgagcacc agcccgaccg acgtgtggtt ctccgggccg      1320
     ctcgcacaca gctggatcgg ctccaacggg ctcgggtggg tggtgacgct gaccctctcg      1380
     gccaccgtct acgcgctgct gcgcaggctg gacggcaccg tccgccaaga ggccgccgga      1440
     cagcgtcccc agcagcaggt cctgtccgct ccggccacgc gggagatctc atga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page