(data stored in ACNUC7421 zone)

EMBL: CP002047.PE24

CP002047.PE24        Location/Qualifiers
FT   CDS_pept        complement(21098..21397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03145"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSW8"
FT                   /protein_id="ADI03145.1"
FT                   /translation="MADVTSTLPRREGQGEGLLLVVDVVEETALYWDRLGALRGFSSVG
FT                   RSIGSPVAVGFVRILGPFEAGYEFTAYVLEQALAFLAAEEDVPRLLLPVVVLAP"
     gtggcggatg tcacgagcac gctgcccagg cgtgagggcc agggtgaggg gcttctgttg        60
     gtggtcgatg tcgtcgaaga gactgcgctg tactgggatc ggctgggtgc tctgcgaggc       120
     ttctcgtcgg tagggaggag catcgggagc ccagtcgcgg tgggctttgt ccggatcctc       180
     gggccgttcg aggcggggta cgagttcacg gcgtacgtgc tcgaacaggc tctcgcgttc       240
     cttgccgctg aggaggacgt gccacgcctg cttctgccag tcgttgtcct cgctccatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page