(data stored in ACNUC7421 zone)

EMBL: CP002047.PE243

CP002047.PE243       Location/Qualifiers
FT   CDS_pept        264103..265104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00243"
FT                   /product="hypothetical protein"
FT                   /note="COG4326 Sporulation control protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03364"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK8"
FT                   /protein_id="ADI03364.1"
FT                   /translation="MVFKRLLGSLGVGGPTVDTVLEGGPVRPGGPLSGQVHLKGGSSDF
FT                   EIEQITLELVARVEAEHEDGEHEGVIAFDRFTVGGGFRLAEGEHRSVPFSVHIPWETPV
FT                   TELYGQPLGVVMGVRTELEVKGAKDKGDLDQLTVGPLPAQEAVLEAFGQLGFGFKSADL
FT                   ELGHIGGTGQTLPFYQEIELAPAPQYAHAVNEIEVTFLAHPGGMEVVLEADKRGGLFSG
FT                   GHDALNRFTVSHDGVEHHDWNAEVDAWVRQLVDSHASHGHHGAPYGQGYAHHDGYGHEG
FT                   HGHEGHHRSGPSTGAVVAGVAAGVAVGVVGGIVAAEVVDEIGDAFEDEEEDD"
     atggtgttca agcgactgct cggctcactc ggtgtcggcg gccccaccgt ggacacggtc        60
     ctggagggcg ggccggtgcg tcccggtggt ccgctgagcg ggcaggtcca tctcaagggc       120
     gggtcctcgg acttcgagat cgagcagatc accctggagc tggtggcccg ggtcgaggcc       180
     gagcacgagg acggggagca tgagggcgtc atcgccttcg accgtttcac ggtcggcggc       240
     gggttccggc tcgccgaggg ggagcaccgc agcgtgccgt tctccgtcca catcccgtgg       300
     gagacgcccg tcaccgagct gtacgggcag ccgctgggcg tcgtcatggg tgtgcgcacc       360
     gagctcgagg tgaagggcgc caaggacaag ggcgacctgg accagctgac cgtgggcccg       420
     ctgcccgcac aggaggcggt cctggaggcg ttcggacagc tcggcttcgg cttcaagtcg       480
     gccgatctgg agctgggcca catcggcggc accgggcaga cgctgccgtt ctaccaggag       540
     atcgagctcg cccccgcccc gcagtacgcg cacgcggtca acgagatcga ggtcaccttc       600
     ctcgcccacc ccggcggcat ggaggtggtt ctggaggccg acaagcgcgg cgggctcttc       660
     tccggcggcc acgacgccct caaccgcttc accgtcagcc acgacggagt cgagcaccac       720
     gactggaacg cggaggtcga cgcctgggtc cggcagctgg tcgacagcca cgcatcgcac       780
     ggccatcacg gcgcgcccta cggacagggt tatgcccacc acgacggcta cggacacgaa       840
     ggccacgggc acgaggggca tcaccgctca ggaccgagca ccggcgccgt ggtcgcgggc       900
     gtcgcggccg gggtcgcggt cggtgtcgtc ggcggcatcg tggccgccga ggtcgtggac       960
     gagatcggcg acgccttcga ggacgaggaa gaggacgact ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page