(data stored in ACNUC7421 zone)

EMBL: CP002047.PE247

CP002047.PE247       Location/Qualifiers
FT   CDS_pept        complement(272492..272875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00247"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03368"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL2"
FT                   /protein_id="ADI03368.1"
FT                   /translation="MVTKQFKGSSLDEADLRRADSLAREIFSDVANKWALLIIEMLGER
FT                   TLRFSELRDEVEGISHKMLTQNLRMLEHNGLVERTVYPTVPPRVEYTLTEPGRALRATV
FT                   DAMCAWTHQYLGHIETARHRFDG"
     atggtgacca agcagttcaa gggcagctcg ctcgacgaag ccgacctgag gcgcgcggat        60
     tccctggcgc gggagatctt ctcggacgtc gccaacaagt gggcgctcct gatcatcgag       120
     atgctcggtg agcgcaccct gcgcttcagc gagctgcggg acgaggtgga gggcatcagc       180
     cacaagatgc tcacccagaa cctgcgcatg ctggagcaca acggcttggt cgagcggacg       240
     gtgtacccca ccgtgccgcc gcgggtcgag tacaccctca ccgaaccggg ccgagcccta       300
     cgggcgacgg tcgatgcgat gtgtgcctgg acacaccagt acctcggcca cattgagacc       360
     gcccgccacc gctttgacgg ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page