(data stored in ACNUC7421 zone)

EMBL: CP002047.PE248

CP002047.PE248       Location/Qualifiers
FT   CDS_pept        272976..273383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00248"
FT                   /product="hypothetical protein"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03369"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL3"
FT                   /protein_id="ADI03369.1"
FT                   /translation="MAITLVNPDGLPKIDVYRQVSIASGSKQIFIAGQVAWDAEGNTVG
FT                   EGDLTAQVEQCYLNIGTALAGVGGSFDDVAKLTVYVVDWTPDKMPALLEGISRAAAKLG
FT                   VTPTPPATLLGVAALDVPDHLVEIEATAILD"
     atggccatca ccctggtgaa ccccgacgga ttgcccaaga tcgatgtcta ccggcaggtg        60
     tcgatcgcat ccgggtcgaa gcagatcttc atcgccgggc aggtcgcctg ggacgccgag       120
     gggaacacgg tcggcgaggg cgacctcacc gcgcaggtcg agcagtgcta cctcaatatc       180
     ggcaccgccc tcgccggggt cggcggctcc ttcgacgatg tggcgaaact gaccgtctac       240
     gtcgtcgact ggacgcccga caagatgccc gcgctcctgg aggggatctc tcgggcggcc       300
     gcgaagctgg gggtcacccc gaccccgccg gccacgctgc tgggcgttgc ggcactggac       360
     gtacccgacc acctcgtcga gatcgaagcc accgcgatcc tcgactga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page