(data stored in ACNUC7421 zone)

EMBL: CP002047.PE251

CP002047.PE251       Location/Qualifiers
FT   CDS_pept        276752..277918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00251"
FT                   /product="hypothetical protein"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03372"
FT                   /db_xref="GOA:D7BWL6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWL6"
FT                   /protein_id="ADI03372.1"
FT                   /translation="MSDELSYRRLPSLTSLRFILACPVIWYHVSYVSGIFDGSLHKSLA
FT                   IVSPFAAGAVSAFFILSGFVVTWVYRPGDRPASFWRRRWWKIVPNHLLAWTATLVLFAV
FT                   AAKQMPMPSPPGDGTAAAVTNLFLVQDWVPDYHLYSGFNTPAWSISCEVFFYALFPALI
FT                   LVARKIPAQRLRPVWAVLAGVIVLIPLVSAAIPGPELYDWLPINERSLWFVYIFPPVRL
FT                   LEFALGIVTARLIQTSTWPRIRRRYLGISLFVLFAALPSLPPQYAMGSAAAPALAVMIA
FT                   RTALADIEGRSRRLPRPALILLGESSYALYITHAPLMMAARYLVGPDPDLAPWVGFAWV
FT                   LGVIAVAIPLSVVVYRYFELPLMRRWSRSRRTPTPPQPAPAPTPASST"
     atgtccgacg agctgtcgta ccgccgtctg ccgtcgttaa caagcttgcg tttcatcttg        60
     gcctgccccg tcatctggta ccacgtcagc tacgtttcgg ggatcttcga cggttccctg       120
     cacaagtcgc tcgctatcgt ctcgccgttt gccgcggggg ccgtgagcgc cttcttcatc       180
     ctctccgggt tcgtggtgac ctgggtgtac agacccggcg accggcccgc ctcgttctgg       240
     cggcgccgct ggtggaagat cgtccccaac catctactcg cctggacggc gaccctggtg       300
     ctcttcgccg tcgccgccaa acagatgccc atgccgtcgc cgcccggaga cgggacggca       360
     gccgcggtca ccaatctgtt cctggtccag gactgggtac ccgactacca cctgtactcg       420
     ggcttcaaca caccggcgtg gtcgatctcc tgtgaggtgt tcttctacgc gctcttcccc       480
     gccctcatcc tcgtcgcgcg caagatcccc gcgcagcggc tgcggccggt gtgggcggtg       540
     ctggccgggg tgatcgtcct gatcccgctg gtgtccgccg ccatccccgg accggagctc       600
     tacgactggc tgcccatcaa cgaacgcagc ctgtggttcg tctatatctt cccgcccgtc       660
     cggctgctgg agttcgccct cggcatcgtc accgcccgcc tgatccagac cagcacctgg       720
     ccccgtatcc gccgccggta cctggggatc tcccttttcg tactcttcgc cgccctgccc       780
     tccctgcccc cgcagtacgc gatgggctcg gcggcggcgc ccgccctcgc agtgatgatc       840
     gcgaggacgg ccctggccga tatcgagggc cgctcacgac gcctgccccg cccggccctg       900
     atcctcctgg gcgagtcctc ctacgccctc tacatcaccc acgccccgct gatgatggcc       960
     gcccgctacc tggtcggacc cgaccccgat ctggcgccgt gggtgggctt cgcatgggtc      1020
     ctcggagtga tcgccgtcgc gatccccctg tccgttgtcg tctaccggta cttcgagctc      1080
     ccgctgatgc gccgctggtc ccgcagccgc cggaccccga ccccgcccca gcccgctccg      1140
     gcgcccactc ccgcttcctc gacgtaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page