(data stored in ACNUC7421 zone)

EMBL: CP002047.PE255

CP002047.PE255       Location/Qualifiers
FT   CDS_pept        complement(282199..283320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00255"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COG1171 Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03376"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM0"
FT                   /protein_id="ADI03376.1"
FT                   /translation="MLENLSSPHALPWLVRPSARTWRCDPAPAEVRGFHATLPDYAPTS
FT                   LAELPELASELGVGRVFAKDESCRLGLPAFKALGASWAVHRTLAERAASGRAPGPVTLV
FT                   TATDGNHGRAVARTARLLGQHAHVFVPQGVHPQAVAAIAAERAEVTEIEGAYDEAVRLA
FT                   ARAAAAPDAVLVQDTAWPGYEQIPGWIVEGYSTLCAEIDEQLAAQGVADGPDLVSIPVG
FT                   VGSLAQAVITHYRSRPSGRAPALLSVEPEAAPCVLESLIRGAPVSVTTGKTTMAGLNCG
FT                   TPSSIAWPHLNGGLDAAVAIPDADSAHAAARLAALGVSSGPCGAATLAGLRAVLTGAGV
FT                   GERRTALGLGATSVVVLLSTEGAAANPHATTDR"
     gtgcttgaga acctttcctc cccccatgcg ctgccgtggc tcgtacggcc cagtgcccgt        60
     acctggcggt gtgatcccgc acccgccgag gtgcggggct tccatgccac gctgcccgac       120
     tacgcaccca cctcgctggc cgaacttccg gagctggcat ccgagttggg cgttggccgg       180
     gtcttcgcca aggacgagtc atgccgtctg gggctgcccg ccttcaaggc gttgggcgcg       240
     tcctgggcgg tccaccgcac cctggccgag cgggccgcga gcggccgagc accgggcccg       300
     gtcaccctgg tgaccgccac cgacggcaac cacggccgtg cggtggcccg tacggcacgc       360
     ctgctcgggc agcacgccca tgtcttcgtc ccgcagggtg tgcatccgca ggccgtggcg       420
     gccatcgccg ccgagcgggc ggaggtcacc gagatcgagg gggcgtacga cgaggccgta       480
     cgcctggcgg cacgggccgc cgccgcaccg gacgcggtcc tggtccagga caccgcctgg       540
     ccgggctatg agcagatccc gggatggatc gtcgagggct actccaccct ctgcgccgag       600
     atcgacgagc agttggcggc acagggcgtc gccgacggac ccgacctcgt ctccatcccg       660
     gtgggcgtgg ggtcgctggc ccaggccgtg atcacccact accgcagccg cccgtcgggg       720
     cgggctccgg cgctgctgtc ggtcgagccg gaggccgcgc cctgcgtcct cgaaagcctc       780
     atccgcggtg cacccgtcag cgtcaccacc ggcaagacca ccatggccgg actgaactgc       840
     ggcaccccgt ccagcatcgc ctggccccat ctcaacggcg ggctggacgc cgcggtcgcc       900
     atcccggacg ccgacagcgc ccacgcggcc gctcgcctcg ccgccctcgg cgtttcctcg       960
     ggcccctgcg gggccgcgac gctcgccggt ctgcgtgcgg tgctcaccgg cgcgggcgtc      1020
     ggagaacgcc gtacggcgct ggggctcggg gcgacctcgg tggtcgtact gctgagcacc      1080
     gagggcgcgg ccgccaaccc gcacgccacc accgatcgct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page