(data stored in ACNUC7421 zone)

EMBL: CP002047.PE256

CP002047.PE256       Location/Qualifiers
FT   CDS_pept        283419..284363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00256"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03377"
FT                   /db_xref="GOA:D7BWM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM1"
FT                   /protein_id="ADI03377.1"
FT                   /translation="MFDLHRLRLLRELKHRGTLAAVATALSYAPSSVSQQLSQLEAEVG
FT                   VPLLEPVGRRVRLTEQAEILVAHTEAVLERLERAEADIATSLTELTGTLRIASFQTAAL
FT                   ALVPTALSLLRELHPHLRVHVTHMEPEKALPALQARDFDLVLAEEYPGNPNPRPAELEQ
FT                   EDLLEDPLHLALPKPAEDTDAPGTDGPDTNTPLVALRSLADHPWVMEPEGTAARHWAMT
FT                   LCRNAGFEPDVRFETTDLLLHLRLVEQKHAAAFLPDLVWSGRAPTVTLQRLPRGRRTRR
FT                   VFTVVRRGRSQHPAVLACRDALLRAAALRSDQA"
     atgttcgatc tgcaccgact gcgtctgctg cgcgaactca aacaccgcgg caccctggcg        60
     gccgtcgcca cggccctgtc ctacgcaccc tcttccgtct cccagcagct ctcccagctg       120
     gaggccgaag tcggcgtccc gctgctggag ccggtcggcc ggcgggtgcg gctgaccgag       180
     caggccgaga tcctggtcgc ccacaccgaa gcggtcctcg aacgcctgga gcgcgcggag       240
     gccgatatcg ccacttccct caccgagctg accggcaccc tgcgcatcgc ctcgttccag       300
     acggccgccc tggccctggt cccgaccgcg ctgagccttc tgcgcgaact gcacccgcac       360
     ctgcgcgtcc atgtcacgca catggaaccg gaaaaggccc tgcccgccct gcaagcccgc       420
     gacttcgacc tggtcctcgc cgaggaatac cccggcaacc ccaacccgcg gcccgccgaa       480
     ctcgaacagg aagacctgct cgaggacccc ctgcacctcg cactgccgaa gccggccgag       540
     gacaccgacg ccccgggcac cgacggcccg gacaccaaca ccccgctggt ggcgctgcgt       600
     tcactggcgg accacccctg ggtgatggaa cccgagggca cagccgcgcg ccactgggcc       660
     atgaccctgt gccgcaacgc cggcttcgag cccgacgtac ggttcgagac caccgacctg       720
     ctgctccacc tccgcctcgt cgagcagaaa cacgccgcgg ccttcctccc cgacctcgtc       780
     tggagcggcc gagctccgac cgtcaccctg caacgactcc cccgtggccg gcgcacgcgc       840
     cgcgtcttca ccgtcgtacg ccgtggccgc agccagcacc ccgccgtcct cgcctgccgc       900
     gacgccctgc tccgggccgc cgccctccgc tccgaccagg catag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page