(data stored in ACNUC7421 zone)

EMBL: CP002047.PE257

CP002047.PE257       Location/Qualifiers
FT   CDS_pept        284471..284977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00257"
FT                   /product="hypothetical protein"
FT                   /note="COG2128 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03378"
FT                   /db_xref="GOA:D7BWM2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM2"
FT                   /protein_id="ADI03378.1"
FT                   /translation="METRSITAEVPMAPRMSEDPAKLVPELAEASAALFKLTGNGSVSR
FT                   STIGLVQLRAGQIVGSTYLTVLHTGFLHKAGESEERITSVASWQDSPYFTGAERAALAL
FT                   VEAVLQPSADGERVSDDLYAQAAEHYDPKALATLMFAIGQVNFFISVALIAKPMPGRSF
FT                   TDPWK"
     atggaaacac gttcgatcac ggccgaggtc ccgatggctc cgcggatgtc cgaggacccc        60
     gcgaagctcg tccccgaact ggcggaggcg tcggcggcgc tgttcaagct caccggcaac       120
     ggttcggtat cgcgctccac gatcggcctg gtccagctgc gtgctggtca gatcgtcggc       180
     agcacctacc tgaccgttct gcacacgggc ttcctgcaca aggccgggga atcggaggag       240
     cggatcacgt cggtggcgtc ctggcaggac tcgccgtact tcacgggtgc cgagcgtgcc       300
     gcgctggcgc ttgtggaagc cgtgctccag ccgtccgcgg atggcgagag ggtttccgac       360
     gacctgtatg cgcaggcggc cgagcactac gaccccaagg cgctcgccac actgatgttc       420
     gcgatcggcc aggtcaactt cttcatctcc gtagcgctca tcgccaagcc gatgcccggc       480
     cggtcgttca ccgacccgtg gaagtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page