(data stored in ACNUC7421 zone)

EMBL: CP002047.PE258

CP002047.PE258       Location/Qualifiers
FT   CDS_pept        285099..285266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00258"
FT                   /product="hypothetical protein"
FT                   /note="COG5515 Uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03379"
FT                   /db_xref="InterPro:IPR013619"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM3"
FT                   /protein_id="ADI03379.1"
FT                   /translation="MPIYRVLTGPDDATFCQRVSEMIGLGYELHEGPAVTFNGERVIVA
FT                   QALIWPTRVR"
     ttgcccatct accgagtcct gaccggaccg gacgacgcca cgttctgcca gcgcgtgagc        60
     gaaatgattg gccttggcta cgaactgcac gaagggcccg ccgtcacctt caacggtgag       120
     agggtcatcg tcgcccaggc gctgatctgg ccgacacggg ttcggtga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page