(data stored in ACNUC7421 zone)

EMBL: CP002047.PE261

CP002047.PE261       Location/Qualifiers
FT   CDS_pept        complement(286993..287766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00261"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="COG2220 Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03382"
FT                   /db_xref="GOA:D7BWM6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM6"
FT                   /protein_id="ADI03382.1"
FT                   /translation="MPTEQIPIRVFGGPTALFEYGGLRFLTDPTFDEPRDYHVPGGQLT
FT                   KTAPSSAAPADLGRIDVVLLSHDEHPDNLDDSGRALLADVPLTLTTPGGGQRLGEGAKG
FT                   LADWESIELDRPGGGTITVTGVPAVHGPGAREDVEPITGQVVGFVLTGENLPAVYVSGD
FT                   NASLDLVKEIAERLGPVDTAILFAGAPRFSVLFDGALIVLDSAQAAEAARILGARRVVP
FT                   VHYDSWAHFTEGRDELIAAFTDAGLLDRLDLGDRG"
     atgcccactg agcagatccc catccgcgtc tttggcggcc cgacggccct tttcgaatac        60
     gggggcctgc gattcctgac cgacccgacc ttcgacgagc cccgtgacta ccacgtgccg       120
     ggcggccaac tgaccaagac ggcgccctcc tccgccgcgc cggccgacct cggccgtatc       180
     gacgtggtcc tgctctccca cgacgaacac cccgacaacc tcgacgactc cggccgcgcc       240
     ctgctcgccg acgttccgct gaccctgacc acgcccgggg gcgggcagcg gctgggggag       300
     ggggccaagg ggctggccga ctgggagtcg atcgagctgg accggcccgg cggcgggacg       360
     atcaccgtca cgggtgtgcc cgccgtccac gggcccggcg cgcgcgagga cgtcgaaccg       420
     atcaccggcc aggtcgtcgg attcgttctg accggggaga accttcccgc ggtctacgtc       480
     agcggcgaca acgcctcgct cgacctggtc aaggagatcg ccgaacggct cggcccggtg       540
     gacaccgcca tcctcttcgc cggggctccc cgcttctccg tcctcttcga cggcgcgctg       600
     atcgtcctcg acagcgcgca ggccgccgaa gctgctcgga tcctcggtgc ccgccgggtg       660
     gtgcccgtcc actacgacag ctgggcgcac ttcaccgagg gccgcgacga actgatcgcc       720
     gcctttacgg acgccgggct gctcgaccgc ctggacctgg gcgaccgggg ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page