(data stored in ACNUC7421 zone)

EMBL: CP002047.PE262

CP002047.PE262       Location/Qualifiers
FT   CDS_pept        287867..288463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03383"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWM7"
FT                   /protein_id="ADI03383.1"
FT                   /translation="MSETPTAESVPPPAPGAEEYLALDFANSAIALPGGHFIDLLGTPE
FT                   ATNRWLTERGLAPADAGVQEMCAAQLRSLREHLRSLFAARVAGLPALPAALSAVNDALS
FT                   KAPTAALLYWDEKNGPYRAAPCPTNEILDRALAALAANAADLLTGPDADRLTGCGSTPC
FT                   NRYLLRHGRRHWCSTRCGDRARAARAYARRTRPEA"
     atgagcgaga ccccgaccgc cgaatccgtg ccaccgcccg cgccgggggc ggaggaatac        60
     ctcgccctcg acttcgccaa cagcgccatc gcgctgcccg gtgggcactt catcgatctc       120
     ctcggcaccc ccgaggccac gaatcgttgg ctcaccgaac gcggcctcgc accggccgac       180
     gcaggggtgc aggagatgtg cgcggcgcag ctgcgctccc ttcgcgaaca cctcagatcg       240
     ctgttcgccg cccgcgttgc cgggctgccc gccctgcccg cggcgctgtc cgccgtcaac       300
     gacgcgctga gcaaagctcc cacggccgcc ctgctgtact gggacgagaa gaacggcccc       360
     taccgcgcgg ccccgtgccc caccaacgaa atcctcgacc gcgccctcgc ggccctcgcg       420
     gccaacgcgg ccgacctcct caccggcccc gacgccgacc gcctcaccgg ttgcggctct       480
     accccctgca accgctatct gctgcgccac ggtcgccgcc actggtgctc cacccgctgc       540
     ggcgaccgcg cccgcgccgc ccgcgcctac gcccgacgca cccgcccgga agcgtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page