(data stored in ACNUC7421 zone)

EMBL: CP002047.PE266

CP002047.PE266       Location/Qualifiers
FT   CDS_pept        complement(291783..293237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00266"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily
FT                   protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03387"
FT                   /db_xref="GOA:D7BWN1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN1"
FT                   /protein_id="ADI03387.1"
FT                   /translation="MACLGQFMVLLDSTIVGAALPDMQERLHTQLSGLQWIVDAYVLLV
FT                   AMLLLSGGVFADRFGRKRVFLAGVVVFTVASVVCSVAPSIGWLIAGRAVQGIGAAALSP
FT                   ASLALLAAAYPVPQERVKAIGLWAGFSGIGLAAGPLAGGILVDAFGWPAIFLVNVPIGA
FT                   VLLLAGLRVLSESRNPSAPAIDIPGTVLSVLGVGALAYGLIEGGSRGWTSPVILGSFAA
FT                   AVVILAVFVAVEARSSTPMLPLRLFRQQLFTVSNTAMVVVGFALMGSSFFFSQFFVYVQ
FT                   GSSILRAGLQTLPASLAMVIVSPYAGRLAAKYGFRIVVTTGLALAGLGLLALGFVHADT
FT                   GYGNVWWRLAVVGIGFALTMSPLTGAAIQAVSPQEGGLASGISSTTRQIGAVLGVAVLG
FT                   AIVRTRESGGASFEAGLNSAFVVAGAVTLAGAVFTGLWLVKSEPSRVPGPTAGRSPLPS
FT                   DRSQGQRGGAGPDPRGVLESTPDPRT"
     gtggcctgtc tggggcagtt catggtgctg ctcgacagca ccatcgtcgg cgcggcactg        60
     cccgatatgc aggagcgatt gcacacccag ctgagcggtc tgcagtggat tgtcgacgcc       120
     tatgtgctgc tggtcgccat gctgttgctg tccggcggcg tcttcgccga ccgattcggc       180
     cgcaagcggg tgttcctggc gggcgtcgtg gtgttcaccg tcgcgtccgt ggtgtgctcc       240
     gtcgcgccgt cgatcggttg gctgatcgcc ggacgggcgg tgcagggtat cggggccgcg       300
     gcgctgagcc ccgcctcgct ggcgctgctc gccgccgcgt atcccgtacc gcaggaacga       360
     gtcaaggcga tcgggttgtg ggccggattc agcggaatcg gcctggccgc cggaccgctg       420
     gccggtggca ttctggtgga tgccttcggc tggcccgcca tcttcctcgt caatgtgccc       480
     atcggcgcgg tcctgctgct ggccggactg cgtgtcctga gcgagtcccg caatccgagc       540
     gcgccggcga tcgacatccc ggggacggtc ctgtccgtcc tgggtgtggg ggcgctggcc       600
     tatgggctga tcgagggcgg ttcccgtggc tggacctcgc cggtgatcct gggcagcttc       660
     gccgccgcgg tggtgatcct cgccgtcttc gtcgccgtcg aagcacgtag ttcgacgccg       720
     atgctgccgc tgcggctgtt ccggcagcaa ctgttcacgg tgtccaacac ggccatggtc       780
     gtggtgggtt tcgcgctcat gggctcgtcc ttcttcttct cccagttctt cgtgtacgtc       840
     cagggcagtt cgattctgcg cgccggtctg cagaccctgc ccgcctccct cgccatggtg       900
     atcgtcagcc cgtacgcggg ccgcctcgcc gcgaagtacg gcttccggat cgtggtcacc       960
     accggcctgg ctctggccgg tctcgggctg ctggcgctgg gctttgtgca cgcggacacc      1020
     ggatacggga atgtgtggtg gcggctggcg gtcgtcggca tcggtttcgc cctgaccatg      1080
     tccccgctga ccggcgccgc catccaggcg gtcagcccgc aggagggcgg cctcgcatcg      1140
     ggcatcagca gcaccacccg tcagatcggc gcggtgctcg gcgtggccgt gctcggagcc      1200
     atcgtccgca cccgggagtc cggtggcgcg tccttcgagg ccggcctcaa cagcgccttc      1260
     gtcgtggccg gcgccgtcac cctggccggc gcggtgttca ccggtctgtg gctggtgaag      1320
     tccgagccga gccgtgtgcc cggtccgaca gcagggcgaa gtcctctgcc gtcggaccgg      1380
     tcccagggtc aacgtggcgg agcagggcct gacccgcgtg gtgttctcga gtccacaccc      1440
     gatccgcgta cgtga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page