(data stored in ACNUC7421 zone)

EMBL: CP002047.PE268

CP002047.PE268       Location/Qualifiers
FT   CDS_pept        complement(293900..294763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03389"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN3"
FT                   /protein_id="ADI03389.1"
FT                   /translation="MRARPAAVAAVCLVAAGCSSGGADPAGSSPARHTPRPPAPTREVR
FT                   NLVLPFDAYTLDSPQVARIAVAQDRLIGSCMARRGFQWLRLPERRTESWPNRGRYGLIE
FT                   AEPAKRYGYHPLPDPRSEAAEAWIARREEGLTPKERTAAYGRDGTSGCEKEAARELLRN
FT                   VPKVDFGRLDRISADTYERAKRHPDVVKAFARWSACMRAEGFRYPDPMAANNDHRWTGD
FT                   SPSQAEIATARADVACKRRTSLVRIWWRTEADYQERQIQQHAKWFARIRLARTRYLTNV
FT                   DAHDDA"
     atgcgcgctc gcccggccgc cgtggccgcc gtgtgcctgg tcgccgctgg atgctccagc        60
     ggcggagccg acccagcggg cagcagcccc gcgcggcaca cgccccggcc cccggccccc       120
     acgcgggagg tgagaaacct cgtccttccc ttcgacgcct acaccctcga cagccctcag       180
     gtggcacgga tcgcggtggc gcaggaccgt ctgatcggat cctgcatggc gcgcagggga       240
     ttccagtggc tccggctgcc cgagcgccgc accgagtcct ggccgaaccg cggtcggtac       300
     gggctgatcg aagcggagcc cgcgaagcgg tacggatacc accccctgcc cgatcctcgc       360
     tccgaggccg ccgaggcatg gatcgcccgg cgcgaggagg gactcacccc gaaggagcgg       420
     acagccgcct acggcaggga cggcacgtcg ggctgcgaga aagaggcggc ccgcgagctg       480
     ctgcgcaacg tgcccaaagt cgacttcggc cgcttggacc ggatctcggc cgacacctac       540
     gagcgcgcca aacgccatcc ggacgtggtc aaggcgttcg cccgctggag cgcctgtatg       600
     cgtgccgagg gcttccgcta cccggacccg atggccgcca acaacgacca ccggtggaca       660
     ggggattccc cctcgcaagc ggagatcgcc accgcccggg ccgatgtcgc ctgcaagcgc       720
     cgtacatcgt tggtgcgcat ctggtggcgg accgaggccg actaccagga gcggcagatc       780
     cagcagcacg cgaagtggtt cgcccggatc cgtctcgcgc ggacccgata cctgacgaac       840
     gtcgacgctc acgacgacgc ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page