(data stored in ACNUC7421 zone)

EMBL: CP002047.PE269

CP002047.PE269       Location/Qualifiers
FT   CDS_pept        complement(294837..295247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN4"
FT                   /protein_id="ADI03390.1"
FT                   /translation="MRLGLGAGAMAVAGAFLLAPTAGASPAAPDHARGATTAAAACPAP
FT                   LHAYQYTNYTGGYKKFCKSDYKLSDNRFNNGGKVNDHIRSVKNLTRGCYWTLWTDYWNR
FT                   GRKTQMDPWSWDSNLANNRVGYKTSSLYKWCN"
     atgcggcttg ggctgggcgc gggggccatg gcggtcgccg gcgcgtttct cctggcgccg        60
     acggcgggcg ccagccccgc cgcaccggac cacgcacgtg gtgccacgac cgctgcggcg       120
     gcgtgccccg cgccgctgca cgcgtaccag tacacgaact acaccggtgg ctacaagaag       180
     ttctgcaagt cggactacaa gctgtccgac aaccggttca acaatggggg aaaggtcaac       240
     gaccatatcc gctcggtgaa gaatctcacc cgcggctgtt actggacgct gtggacggac       300
     tactggaacc gcggtcggaa aacccagatg gatccgtgga gctgggactc caatctggcc       360
     aacaaccggg tcggctacaa gaccagctcg ctctacaagt ggtgtaactg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page