(data stored in ACNUC7421 zone)

EMBL: CP002047.PE27

CP002047.PE27        Location/Qualifiers
FT   CDS_pept        23042..23524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03148"
FT                   /db_xref="GOA:D7BSX1"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSX1"
FT                   /protein_id="ADI03148.1"
FT                   /translation="MPLEGEYEPSPAQWVREQVELYESSGGTQGTTLWDTGLPVVIVTM
FT                   RGAKSGRIRKIPLMRVEHEGRYAAVASKAGFPRHPVWYFNLKADPQVDLQDGPKRQGMM
FT                   ARELTGDEKAQWWERAVAAYPPYAEYQEKTNRVIPVFVLEPEHLAGPAKAPAPTRN"
     atgcctcttg agggcgagta cgagccgagt ccggcgcagt gggtgcgcga acaggtcgag        60
     ctgtacgaga gttcgggtgg cacacagggc acaacgctct gggacacggg cctgccggtc       120
     gtcattgtca cgatgcgcgg cgcgaagagc ggcaggatcc gcaagattcc gctgatgcgc       180
     gtggagcacg aggggcggta cgcggcggtg gcctcgaagg ccggcttccc gcgccacccg       240
     gtctggtact tcaacctcaa ggccgacccg caggtggatc tccaagacgg ccccaaacgc       300
     cagggcatga tggcccgtga gctcaccggg gacgagaagg cccagtggtg ggagcgcgcg       360
     gtcgccgcgt atccgccgta cgccgaatac caggagaaga ccaaccgcgt gatcccagtc       420
     ttcgtactcg aacccgagca cctggccggg ccggcgaagg ccccggcgcc gacgaggaac       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page