(data stored in ACNUC7421 zone)

EMBL: CP002047.PE272

CP002047.PE272       Location/Qualifiers
FT   CDS_pept        complement(297775..298221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00272"
FT                   /product="hypothetical protein"
FT                   /note="COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03393"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN7"
FT                   /protein_id="ADI03393.1"
FT                   /translation="MGVRLTRYTDLALRAVMRLAVMDGEELLTTRLIADSMNVPYTHMA
FT                   KTIAHLQHLGVVEARRGRNGGLMLTDAGRNTRVGELIRVLEGDREAVVCEGEAPCPLAG
FT                   ACRLRRALRDAQEAFYASLDQVTVADLVASPAGPVLLTLGSAPG"
     gtgggcgtga ggctgaccag gtacacggat ctcgcgcttc gggcggtgat gcgcctggcc        60
     gtcatggacg gcgaggaact gctgaccacg aggctcatcg ccgattccat gaacgtcccc       120
     tatacgcata tggcgaagac gatcgcccat ctgcagcacc tgggggtcgt cgaggcgcgg       180
     cgcgggcgca acggcgggct gatgctcacc gacgcgggcc ggaacacgcg ggtgggcgag       240
     ctgatccggg tactggaggg ggaccgtgag gccgtggtgt gcgaggggga ggccccctgc       300
     ccgctggccg gtgcctgtcg attgcggcgg gccttgcgtg acgcgcagga ggcgttctat       360
     gcctcgctgg accaggtgac cgtggccgat ctggtggcct cgccggcggg gccggtactg       420
     ctgacgctgg gctccgcccc gggctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page