(data stored in ACNUC7421 zone)

EMBL: CP002047.PE274

CP002047.PE274       Location/Qualifiers
FT   CDS_pept        299745..300683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00274"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03395"
FT                   /db_xref="GOA:D7BWN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWN9"
FT                   /protein_id="ADI03395.1"
FT                   /translation="MTTLTSTPGGATIRHPAPPSATTGSRTPRQGGTILAVPALIWYAI
FT                   FMIGPVIAIFVIAALHWPGMLQPVSFAGLDNVRTVFDDPVFWDAVNNTAVQLAVALPIM
FT                   IVCAYMLGYYVAQKPPGHRVIRYLLFIPGLISTPAKAMVFYAALSPDGLVNGGLQSVGL
FT                   GSLTDAWLASPSTALACLIALDIWSGIGFTAVLFAARLDSVPDELGEAAQLDGAGHWRT
FT                   MWRVHFPVIRDYVGVVTMLQFLWTLFGSAQHVLLLTQGGPGSSSTTLSFLVYQKAFIAA
FT                   DLGYSQTVGVILFLAGLVGLLAIRRVFRQNY"
     atgacgacgc tgacgtcgac cccgggcggg gccacgatcc gccaccccgc tccgccctcc        60
     gccacaaccg gttcgcgtac gccccgacag ggcggcacga tcctcgccgt ccccgcgctg       120
     atctggtacg cgatcttcat gatcggtccg gtgatcgcca tctttgtgat cgccgccctg       180
     cactggccgg ggatgctcca gccggtgtcc ttcgccggtc tcgacaacgt ccgcacggtc       240
     ttcgacgacc ccgtgttctg ggacgcggtg aacaacaccg ccgtccagct ggccgtggcg       300
     ctgccgatca tgatcgtatg cgcctatatg ctgggctact acgttgcgca gaagcccccc       360
     ggacaccgtg tcatccgcta tctgctgttc atccccggtc tgatctccac ccccgccaag       420
     gccatggtgt tctacgcggc gctgtccccg gacggtctgg tcaacggcgg gttgcagtcc       480
     gtggggctcg gttcgctcac cgacgcctgg ctcgcctcgc cgtcgacggc tctggcctgt       540
     ctcatcgccc tggacatatg gagcgggatc ggcttcaccg ccgtcctgtt cgccgcccgg       600
     ctcgacagcg ttccggacga gctcggcgag gcggcgcagc tggacggggc cggacactgg       660
     cggaccatgt ggcgcgtcca cttccccgtg atccgcgact atgtcggcgt cgtcaccatg       720
     ctgcagttcc tgtggaccct cttcggctcg gcgcagcacg ttctgctgct cacccagggc       780
     ggccccggca gttcgtcgac aacgctgtcg ttcctcgtct accagaaggc gttcatcgcg       840
     gccgacctgg gttacagcca gaccgtcggc gtcatcctct ttctggccgg gctcgtcggg       900
     ctgctcgcca tccgccgcgt gtttcgccag aactactga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page