(data stored in ACNUC7421 zone)

EMBL: CP002047.PE275

CP002047.PE275       Location/Qualifiers
FT   CDS_pept        300698..301525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00275"
FT                   /product="binding-protein dependent transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03396"
FT                   /db_xref="GOA:D7BWP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP0"
FT                   /protein_id="ADI03396.1"
FT                   /translation="MKLSKRWLPAHLLVWTYAVLLIVPLYYFLASAFKSNEEIFAHPFA
FT                   LPDSLGFGNFRTAYDSASLGQAIVNSALVTVLALALTLLLALPASFALARSTGRLASAV
FT                   EKVFSLGFLIPTFAALFPTFLLAAATGLFHTQLFMVLFLPATAMPLSVVILVQFMRTIP
FT                   REMEEAARIDGASTYTVLRHIYTPMCLPGIATVILLNFLTFWNEYLYSLVIIGPDPDQR
FT                   TVQSALPTLKAITGTDYGVLTAGTVLTLIPVWIVYTVLQKRMQQALISGAVKM"
     atgaaactca gcaaacgctg gctgcccgca caccttctgg tgtggaccta cgcggtgctg        60
     ctgatcgtgc cgctctacta cttcctcgcc tccgcgttca agagcaacga ggagatcttc       120
     gcccacccct tcgccctgcc ggactcgctc ggcttcggca acttccggac ggcgtacgac       180
     agcgcctccc tgggccaggc catcgtcaac tcggcgctgg tgacggtcct tgctctggcg       240
     ctgaccctgc tgctggcgct gcccgcgtcg ttcgcgctcg cccggtcgac cgggcggctg       300
     gcctcggcgg tggagaaggt gttctcgctc ggctttctga tcccgacgtt cgcggcgctc       360
     tttcccacgt tcctgctcgc cgcggccacc ggactgttcc atacgcagct cttcatggtc       420
     ctcttcctgc ccgcgacggc gatgccgctg tcggtggtga tcctggtgca gttcatgcgg       480
     accatcccga gggagatgga ggaggccgcc cggatcgacg gggcgtccac ctacacggtg       540
     ctgcgccaca tctatacgcc gatgtgtctg cccggcatcg ccaccgtgat cctcctgaac       600
     ttcctgacgt tctggaacga gtacctgtac tcgctcgtca tcatcggccc tgaccccgac       660
     cagcgcaccg tccagtcggc cctgcccacg ctcaaggcga tcaccggcac cgactacggc       720
     gtcctcaccg cgggcaccgt actgaccctc atccccgtat ggatcgtcta cacggtgctg       780
     cagaagcgta tgcagcaggc actcatcagc ggtgcggtga agatgtga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page