(data stored in ACNUC7421 zone)

EMBL: CP002047.PE277

CP002047.PE277       Location/Qualifiers
FT   CDS_pept        302676..304619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00277"
FT                   /product="hypothetical protein"
FT                   /note="COG3934 Endo-beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03398"
FT                   /db_xref="GOA:D7BWP2"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWP2"
FT                   /protein_id="ADI03398.1"
FT                   /translation="MRRHSAQLTHHPAVLPWLGANFWSRTGGPLMWRDYDPKTVRAELR
FT                   VLHEHGLTMTRSFFYWPDFHPQPHRIDEALCEHFRDFLDAHSETGMGTVPTFIVGHMSG
FT                   ENWDPAWRGGRDLYEDVWMVGRQAWFVSQMTRRFKDHPAVTGWLITNEMPGYGRVYQVD
FT                   PPSSEVVTAWAQAMCNAVRAAGGTQPVSLGDGAWGIEVTGRDNGFSLRETAEYVDFVGP
FT                   HVYRSDTDRPRQHLRAAFECELASVTGHPVVLEEFGLSTDTVSAENAAVYYRQTLHNSL
FT                   LGGATGWIAWNNTDYDDLWDRSPYDHHPFEMHFGITDSTGAPKTPLLELADFAKVLGDV
FT                   DFTRCRRADAGAALVVPAFLERGYPYSRPADRPLIFTSLHQSYVATRAADLPVGFTREA
FT                   DGLPGDAALYLLPATRQLTTRTRRELEHRAHEGATVYLSFCSGEHPGTRGPWFDDLDGL
FT                   FGVELQLSYGVAEPIEDVVLEMTFTDDFGGLTAGDTLRFPVAGNEDSRAYLPVLPRDAR
FT                   VVAVDAHGRPALLVRDTGRGRTVLATYPLEHMAARTARVNPEETHRLYAALADVAGVRR
FT                   PVTVDSPHVGADVLVHQDGRRFVWLVSQSPVELTVRPAADGTLHDLASGAPTADVTLAP
FT                   YGVCVLELKCWS"
     atgcgacgcc acagcgccca gctcacccac caccccgccg tcctgccctg gctcggcgcc        60
     aacttctggt cccgcaccgg cgggcccctg atgtggcgcg actacgaccc caagacggtc       120
     cgcgcggaac tgcgggtgct gcacgagcac ggcctgacca tgacccggtc gttcttctac       180
     tggcccgact tccatccgca accgcaccgc atcgacgagg cgctgtgcga acacttccgc       240
     gacttcctcg acgcccacag cgagacgggc atggggacgg tgcccacctt catcgtcgga       300
     catatgtcgg gcgagaactg ggacccggcc tggcgcgggg gccgcgatct gtacgaggac       360
     gtgtggatgg tcggccgcca ggcgtggttc gtatcccaga tgacccgccg cttcaaggac       420
     cacccggcgg tcacgggctg gctcatcacc aatgagatgc cgggatacgg ccgcgtctac       480
     caggtggatc cgccctcctc cgaggtggtg accgcctggg cgcaggccat gtgcaacgcc       540
     gtacgggccg ccggcggcac ccagcccgtc tctctcggcg acggtgcgtg gggcatcgag       600
     gtcaccggcc gcgacaacgg cttctcgctg cgcgagaccg ccgagtacgt cgacttcgtc       660
     ggaccgcatg tgtaccgctc cgacaccgac cggccccgcc agcatctgcg cgccgccttc       720
     gaatgcgaac tggcctcggt caccggacac cccgtcgtac tggaggagtt cggcctttcc       780
     acggacacgg tgtccgccga gaacgcggcg gtctactacc ggcagaccct gcacaactcg       840
     ctgctcggcg gtgcgacggg ctggatcgcc tggaacaaca ccgactacga cgatctatgg       900
     gaccgctcgc cgtacgatca ccaccccttc gaaatgcact tcggcatcac cgacagcacc       960
     ggggccccca agactcctct gcttgaactc gccgacttcg cgaaggtgtt gggggacgtg      1020
     gacttcacgc gctgccgacg cgccgacgca ggagcggcgc tggtcgtgcc cgccttcctg      1080
     gagcgcggct acccctacag caggcccgcc gaccgaccgc tgatcttcac ttccctgcac      1140
     cagagctacg tcgccacccg cgccgccgac ctgccggtgg gcttcacccg ggaggccgac      1200
     ggcctgcccg gcgacgcggc cctgtatctg ctgccggcca cccgtcagct caccacacgc      1260
     acccggcgtg agctcgaaca ccgcgcccac gagggcgcca cggtctatct ctcgttctgc      1320
     tccggcgaac accccggcac ccgcggcccg tggttcgacg acctggacgg gctgttcggc      1380
     gtcgagctcc agctctccta cggtgtcgcc gagcccatcg aggacgttgt cctggagatg      1440
     acgttcaccg acgacttcgg cgggctgacc gcgggagaca ccctgcgctt cccggtcgcg      1500
     ggcaacgagg acagccgggc gtatctgccg gtccttcccc gcgatgcccg tgtcgtcgcc      1560
     gtcgacgcac acggccggcc cgccctcctg gtgcgcgaca ccggacgcgg ccgcaccgtc      1620
     ctggccacct accctctgga gcatatggcc gcccgtaccg cccgggtcaa ccccgaggag      1680
     acccaccggc tgtacgcggc gctcgccgat gtcgccgggg tccggcgccc ggtgacggtc      1740
     gacagcccgc acgtcggtgc ggacgtcctc gtccaccagg acggccgccg cttcgtctgg      1800
     ctggtcagcc agagccccgt ggagctcacc gtccgccccg ccgccgacgg cacactgcac      1860
     gacctcgcgt ccggcgcgcc gaccgcggat gtgacactcg ccccgtacgg tgtctgcgtc      1920
     cttgagctga agtgctggag ctga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page